TRIM Recombinant Protein Antigen Summary
Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TRIM Source: E. coli
Amino Acid Sequence: IDASVSKTTLVDSFSPESQAVEENIHDDPIRLFGLIRAKREPIN Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
Source |
E. coli |
Protein/Peptide Type |
Recombinant Protein Antigen |
Gene |
TRAT1 |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
Dilutions |
- Antibody Competition 10-100 molar excess
|
Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17096. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
Theoretical MW |
23 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS and 1M Urea, pH 7.4. |
Preservative |
No Preservative |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for TRIM Recombinant Protein Antigen
Background
TRIM is a 30 kD disulfide-linked protein also known as T cell receptor interacting molecule. TRIM is a type III membrane protein containing a very short extracellular domain (8 amino acids). TRIM is highly expressed in T cells with some expression also observed in NK cells. TRIM is a signaling adaptor molecule that links extracellular and intracellular signaling. The TRIM protein is phosphorylated by Src kinases and associates with the PI3K regulatory subunit alpha after phosphorylation. TRIM has also been shown to associate with TCR alpha, beta, and zeta. The TRIM-4 monoclonal antibody recognizes human TRIM and has been shown to be useful for Western blotting, intracellular staining by flow cytometry, and immunofluorescence staining.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Gp, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
Species: Am, Bv, Ca, Dr, Hu, Mu, Po, Rt, Sh
Applications: IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA, ICC/IF, PLA, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Hu, Pm
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, WB
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, PLA, WB
Species: Bv, Ca, Hu, Pm, Mu, Rb
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, MiAr, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: AC
Publications for TRIM Recombinant Protein Antigen (NBP3-17096PEP) (0)
There are no publications for TRIM Recombinant Protein Antigen (NBP3-17096PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for TRIM Recombinant Protein Antigen (NBP3-17096PEP) (0)
There are no reviews for TRIM Recombinant Protein Antigen (NBP3-17096PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for TRIM Recombinant Protein Antigen (NBP3-17096PEP) (0)
Additional TRIM Products
Research Areas for TRIM Recombinant Protein Antigen (NBP3-17096PEP)
Find related products by research area.
|
Blogs on TRIM