![Western Blot: TPT1/TCTP Antibody (2A3) [H00007178-M06] - Analysis of TPT1 expression in NIH/3T3.](http://images.novusbio.com/fullsize/TPT1-TCTP-Antibody-2A3-Western-Blot-H00007178-M06-img0004.jpg "Western Blot: TPT1/TCTP Antibody (2A3) [H00007178-M06] - Analysis of TPT1 expression in NIH/3T3.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ELISA |
| Clone | 2A3 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | TPT1 (AAH22436, 35 a.a. ~ 138 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GVDIVMNHHLQETSFTKEAYKKYIKDYMKSIKGKLEEQRPERVKPFMTGAAEQIKHILANFKNYQFFIGENMNPDGMVALLDYREDGVTPYMIFFKDGLEMEKC |
| Isotype | IgG2b Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | TPT1 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | It has been used for ELISA and WB. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for TPT1/TCTP Antibody (H00007178-M06)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: TPT1/TCTP Antibody (2A3) [H00007178-M06] - Analysis of TPT1 expression in PC-12.](http://images.novusbio.com/fullsize/TPT1-TCTP-Antibody-2A3-Western-Blot-H00007178-M06-img0001.jpg "Western Blot: TPT1/TCTP Antibody (2A3) [H00007178-M06] - Analysis of TPT1 expression in PC-12.")
![Western Blot: TPT1/TCTP Antibody (2A3) [H00007178-M06] - Analysis of TPT1 expression in IMR-32.](http://images.novusbio.com/fullsize/TPT1-TCTP-Antibody-2A3-Western-Blot-H00007178-M06-img0002.jpg "Western Blot: TPT1/TCTP Antibody (2A3) [H00007178-M06] - Analysis of TPT1 expression in IMR-32.")
![Western Blot: TPT1/TCTP Antibody (2A3) [H00007178-M06] - Analysis of TPT1 expression in Raw 264.7.](http://images.novusbio.com/fullsize/TPT1-TCTP-Antibody-2A3-Western-Blot-H00007178-M06-img0003.jpg "Western Blot: TPT1/TCTP Antibody (2A3) [H00007178-M06] - Analysis of TPT1 expression in Raw 264.7.")
![Western Blot: TPT1/TCTP Antibody (2A3) [H00007178-M06] - Fab-6HD5 inhibits mast cell degranulation. RBL-2H3 cells were sensitized overnight with IgE (SPE-7) and further incubated with a serial dilution of highly purified Fab-6HD5 (2-20 ug/ml) for 2 hours at 37 C. After washing, cells were incubated with DNP-BSA for 1 hour at 37 C. The supernatant was then incubated with p-nitrophenyl N-acetyl-beta-D-glucosamine (PNAG) for 1 hour at 4 C. IgE-mediated degranulation was monitored by beta-hexosaminidase activity. The amount of beta-hexosaminidase was determined by measuring the optical density at 405 nm. Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/s41598-018-32200-z), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/TPT1-TCTP-Antibody-2A3-Western-Blot-H00007178-M06-img0005.jpg "Western Blot: TPT1/TCTP Antibody (2A3) [H00007178-M06] - Fab-6HD5 inhibits mast cell degranulation. RBL-2H3 cells were sensitized overnight with IgE (SPE-7) and further incubated with a serial dilution of highly purified Fab-6HD5 (2-20 ug/ml) for 2 hours at 37 C. After washing, cells were incubated with DNP-BSA for 1 hour at 37 C. The supernatant was then incubated with p-nitrophenyl N-acetyl-beta-D-glucosamine (PNAG) for 1 hour at 4 C. IgE-mediated degranulation was monitored by beta-hexosaminidase activity. The amount of beta-hexosaminidase was determined by measuring the optical density at 405 nm. Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/s41598-018-32200-z), licensed under a CC-BY license.")
![Western Blot: TPT1/TCTP Antibody (2A3) [H00007178-M06] - (a) Fab-6HD5 inhibits mast cell degranulation. RBL-2H3 cells were sensitized overnight with IgE (SPE-7) & further incubated with a serial dilution of highly purified Fab-6HD5 (2–20 μg/ml) for 2 hours at 37 °C. After washing, cells were incubated with DNP-BSA for 1 hour at 37 °C. The supernatant was then incubated with p-nitrophenyl N-acetyl-beta-D-glucosamine (PNAG) for 1 hour at 4 °C. IgE-mediated degranulation was monitored by beta -hexosaminidase activity. The amount of beta -hexosaminidase was determined by measuring the optical density at 405 nm. (b) Fab-6HD5 inhibits Syk phosphorylation. RBL-2H3 cells were incubated with anti-TNP IgE (0.5 μg/ml) for 1 hour. Cells were further incubated with highly purified 6HD5-Fab (2 μg/ml) or control IgG2a overnight. After washing, cells were stimulated with TNP26-BSA (100 ng/ml) for indicated periods & cell extracts were subjected to Western blotting. Proteins were detected with anti-phosphorylated Syk, anti-Syk, & anti-Tpt1 antibodies followed by HRP-conjugated anti-rabbit or anti-mouse antibody. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30250145), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/h00007178-m06_mouse-monoclonal-tpt1-tctp-antibody-2a3-310202415482230.jpg "Western Blot: TPT1/TCTP Antibody (2A3) [H00007178-M06] - (a) Fab-6HD5 inhibits mast cell degranulation. RBL-2H3 cells were sensitized overnight with IgE (SPE-7) & further incubated with a serial dilution of highly purified Fab-6HD5 (2–20 μg/ml) for 2 hours at 37 °C. After washing, cells were incubated with DNP-BSA for 1 hour at 37 °C. The supernatant was then incubated with p-nitrophenyl N-acetyl-beta-D-glucosamine (PNAG) for 1 hour at 4 °C. IgE-mediated degranulation was monitored by beta -hexosaminidase activity. The amount of beta -hexosaminidase was determined by measuring the optical density at 405 nm. (b) Fab-6HD5 inhibits Syk phosphorylation. RBL-2H3 cells were incubated with anti-TNP IgE (0.5 μg/ml) for 1 hour. Cells were further incubated with highly purified 6HD5-Fab (2 μg/ml) or control IgG2a overnight. After washing, cells were stimulated with TNP26-BSA (100 ng/ml) for indicated periods & cell extracts were subjected to Western blotting. Proteins were detected with anti-phosphorylated Syk, anti-Syk, & anti-Tpt1 antibodies followed by HRP-conjugated anti-rabbit or anti-mouse antibody. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30250145), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot ALK/CD246 Antibody [Unconjugated]](https://images.novusbio.com/images2/ALK_AF4210_Western_Blot_12746.jpg)
![Immunohistochemistry ALK/CD246 Antibody [Unconjugated]](https://images.novusbio.com/images2/12780.jpg)
![Simple Western ALK/CD246 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af4210_human-alk-cd246-affinity-purified-pab-simple-western-296202315837.jpg)
![Western Blot S100A10 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A10_AF2377_Western_Blot_17324.jpg)
![Immunohistochemistry S100A10 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A10_AF2377_Immunohistochemistry_17440.jpg)
![Simple Western S100A10 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A10_AF2377_Simple_Western_18705.jpg)
