![Immunohistochemistry-Paraffin: TPD52 Antibody [NBP2-38952] - Staining in human prostate and skeletal muscle tissues using anti-TPD52 antibody. Corresponding TPD52 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/TPD52-Antibody-Immunohistochemistry-Paraffin-NBP2-38952-img0007.jpg "Immunohistochemistry-Paraffin: TPD52 Antibody [NBP2-38952] - Staining in human prostate and skeletal muscle tissues using anti-TPD52 antibody. Corresponding TPD52 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KSFEEKVENLKSKVGGTKPAGGDFGEVLNSAANASATTTEPLPEKTQESL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TPD52 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunocytochemistry Polycystin-1/PKD1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Polycystin1_AF6270_Immunocytochemistry__Immunofluorescence_20130.jpg)
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for TPD52 Antibody (NBP2-38952)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: TPD52 Antibody [NBP2-38952] - Staining of human cerebral cortex, kidney, prostate and skeletal muscle using Anti-TPD52 antibody NBP2-38952 (A) shows similar protein distribution across tissues to independent antibody NBP1-85327 (B).](http://images.novusbio.com/fullsize/TPD52-Antibody-Immunohistochemistry-Paraffin-NBP2-38952-img0008.jpg "Immunohistochemistry-Paraffin: TPD52 Antibody [NBP2-38952] - Staining of human cerebral cortex, kidney, prostate and skeletal muscle using Anti-TPD52 antibody NBP2-38952 (A) shows similar protein distribution across tissues to independent antibody NBP1-85327 (B).")
![Western Blot: TPD52 Antibody [NBP2-38952] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue. Lane 6: Human tonsil tissue](http://images.novusbio.com/fullsize/TPD52-Antibody-Western-Blot-NBP2-38952-img0003.jpg "Western Blot: TPD52 Antibody [NBP2-38952] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue. Lane 6: Human tonsil tissue")
![Immunocytochemistry/Immunofluorescence: TPD52 Antibody [NBP2-38952] - Staining of human cell line A-431 shows positivity in cytoplasm and the Golgi apparatus.](http://images.novusbio.com/fullsize/TPD52-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38952-img0001.jpg "Immunocytochemistry/Immunofluorescence: TPD52 Antibody [NBP2-38952] - Staining of human cell line A-431 shows positivity in cytoplasm and the Golgi apparatus.")
![Immunohistochemistry-Paraffin: TPD52 Antibody [NBP2-38952] - Staining of human kidney.](http://images.novusbio.com/fullsize/TPD52-Antibody-Immunohistochemistry-Paraffin-NBP2-38952-img0010.jpg "Immunohistochemistry-Paraffin: TPD52 Antibody [NBP2-38952] - Staining of human kidney.")
![Immunohistochemistry-Paraffin: TPD52 Antibody [NBP2-38952] - Staining of human prostate shows high expression.](http://images.novusbio.com/fullsize/TPD52-Antibody-Immunohistochemistry-Paraffin-NBP2-38952-img0005.jpg "Immunohistochemistry-Paraffin: TPD52 Antibody [NBP2-38952] - Staining of human prostate shows high expression.")
![Immunohistochemistry-Paraffin: TPD52 Antibody [NBP2-38952] - Staining of human skeletal muscle shows low expression as expected.](http://images.novusbio.com/fullsize/TPD52-Antibody-Immunohistochemistry-Paraffin-NBP2-38952-img0006.jpg "Immunohistochemistry-Paraffin: TPD52 Antibody [NBP2-38952] - Staining of human skeletal muscle shows low expression as expected.")
![Immunohistochemistry-Paraffin: TPD52 Antibody [NBP2-38952] - Staining of human cerebral cortex.](http://images.novusbio.com/fullsize/TPD52-Antibody-Immunohistochemistry-Paraffin-NBP2-38952-img0009.jpg "Immunohistochemistry-Paraffin: TPD52 Antibody [NBP2-38952] - Staining of human cerebral cortex.")
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![ENPP-2/Autotaxin [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "ENPP-2/Autotaxin [Unconjugated]")
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")