![Immunohistochemistry-Paraffin: TOX Antibody [NBP1-87857] - Staining in human tonsil and liver tissues. Corresponding TOX RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/thymocyte-selection-associated-high-mobility-group-box-Antibody-Immunohistochemistry-Paraffin-NBP1-87857-img0012.jpg "Immunohistochemistry-Paraffin: TOX Antibody [NBP1-87857] - Staining in human tonsil and liver tissues. Corresponding TOX RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant TOX Protein corresponding to amino acids: PDAPCLGPSPCLDPYYCNKFDGENMYMSMTEPSQDYVPASQSYPGPSLESEDFNIPPITPPSLPDHSLVHLNEVESGYHSLCHPMNHNGLLPFHPQN |
| Predicted Species | Mouse (98%), Rat (98%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TOX |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-87857 | Applications | Species |
|---|---|---|
| McGirt LY, Adams CM, Baerenwald DA et al. miR-223 regulates cell growth and targets proto-oncogenes in mycosis fungoides/cutaneous T-cell lymphoma. J Invest Dermatol 2014-04-01 [PMID: 24304814] |
Secondary Antibodies |
Isotype Controls |
Research Areas for TOX Antibody (NBP1-87857)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TOX |
![Western Blot: TOX Antibody [NBP1-87857] - Analysis in human cell line MOLT-4.](http://images.novusbio.com/fullsize/thymocyte-selection-associated-high-mobility-group-box-Antibody-Western-Blot-NBP1-87857-img0009.jpg "Western Blot: TOX Antibody [NBP1-87857] - Analysis in human cell line MOLT-4.")
![Immunohistochemistry-Paraffin: TOX Antibody [NBP1-87857] - Staining of human tonsil shows strong nuclear positivity in germinal center cells and a subset of non-germinal center cells.](http://images.novusbio.com/fullsize/thymocyte-selection-associated-high-mobility-group-box-Antibody-Immunohistochemistry-Paraffin-NBP1-87857-img0006.jpg "Immunohistochemistry-Paraffin: TOX Antibody [NBP1-87857] - Staining of human tonsil shows strong nuclear positivity in germinal center cells and a subset of non-germinal center cells.")
![Immunohistochemistry-Paraffin: TOX Antibody [NBP1-87857] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/thymocyte-selection-associated-high-mobility-group-box-Antibody-Immunohistochemistry-Paraffin-NBP1-87857-img0007.jpg "Immunohistochemistry-Paraffin: TOX Antibody [NBP1-87857] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: TOX Antibody [NBP1-87857] - Staining of human duodenum shows strong nuclear positivity in a subset of glandular cells.](http://images.novusbio.com/fullsize/thymocyte-selection-associated-high-mobility-group-box-Antibody-Immunohistochemistry-Paraffin-NBP1-87857-img0008.jpg "Immunohistochemistry-Paraffin: TOX Antibody [NBP1-87857] - Staining of human duodenum shows strong nuclear positivity in a subset of glandular cells.")
![Immunohistochemistry-Paraffin: TOX Antibody [NBP1-87857] - Staining of human pancreas shows nuclear positivity in islets of Langerhans.](http://images.novusbio.com/fullsize/thymocyte-selection-associated-high-mobility-group-box-Antibody-Immunohistochemistry-Paraffin-NBP1-87857-img0010.jpg "Immunohistochemistry-Paraffin: TOX Antibody [NBP1-87857] - Staining of human pancreas shows nuclear positivity in islets of Langerhans.")
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")