Home » TORC2 » TORC2 Proteins » TORC2 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

TORC2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for TORC2 Protein (NBP1-86925PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals offers 100% Guarantee

TORC2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CRTC2.

Source: E. coli

Amino Acid Sequence: ALNRTSSDSALHTSVMNPSPQDTYPGPTPPSILPSRRGGILDGEMDPKVPAIEENLLDDKHLLKPWDAKKLSSSSSRPRSCEVPGIN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CRTC2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86925.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TORC2 Recombinant Protein Antigen

  • CREB regulated transcription coactivator 2
  • CREB-regulated transcription coactivator 2
  • CRTC2
  • TORC2
  • TORC-2
  • TORC2transducer of regulated cAMP response element-binding protein (CREB) 2
  • Transducer of CREB protein 2
  • Transducer of regulated cAMP response element-binding protein 2

Background

TORC2 (transducer of regulated CREB activity 2) is part of a family of CREB (cAMP response element-binding protein) coactivators that also includes TORC1 and TORC3. These proteins function to activate CREB-dependent transcription in response to cAMP and calcium signaling pathways. TORC2 has been found to be pivotal to the process of gluconeogenesis. TORC2 is also known as CREB regulated transcription activator 2, and CRTC2.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

TOR/mTOR [p
Ser2448] Antibody
NB600-607
Immunohistochemistry-Paraffin TOR/mTOR [p Ser2448] Antibody
Western Blot TOR/mTOR [p Ser2448] Antibody
Data TOR/mTOR [p Ser2448] Antibody
(2 Reviews)
(9 Publications)
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
AKT [p Ser473]
Antibody [Unconjugate ...
AF887
Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
(50 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
TORC1 Antibody
NBP1-89865
Immunohistochemistry-Paraffin TORC1 Antibody
Immunohistochemistry-Paraffin TORC1 Antibody
Immunohistochemistry-Paraffin TORC1 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
CREB [p Ser133]
[Biotin]
DYC2510-2
N/A CREB [p Ser133] [Biotin]
N/A CREB [p Ser133] [Biotin]
N/A CREB [p Ser133] [Biotin]
(9 Publications)
Species: Hu, Mu, Rt
Applications: ELISA
Rictor Antibody
(7B3) - BSA Free
NBP1-51645
Flow Cytometry Rictor Antibody (7B3) - BSA Free
Immunocytochemistry/ Immunofluorescence Rictor Antibody (7B3) - BSA Free
Immunohistochemistry-Paraffin Rictor Antibody (7B3) - BSA Free
(1 Review)
(2 Publications)
Species: Hu, Mu, Pm
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
ROR
gamma/RORC/NR1F3 Anti ...
NBP2-24503
Immunohistochemistry-Paraffin ROR gamma/RORC/NR1F3 Antibody - BSA Free
Western Blot ROR gamma/RORC/NR1F3 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence ROR gamma/RORC/NR1F3 Antibody - BSA Free
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
RPTOR Antibody
NBP2-24837
Immunocytochemistry/ Immunofluorescence RPTOR Antibody
Immunohistochemistry-Paraffin RPTOR Antibody
Western Blot RPTOR Antibody
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
PIK3CA Antibody
NBP2-19804
Western Blot PIK3CA Antibody
Immunohistochemistry-Paraffin PIK3CA Antibody
Western Blot PIK3CA Antibody
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
PI 3-Kinase p110
beta/PIK3CB Antibody ...
MAB2686
Western Blot PI 3-Kinase p110 beta/PIK3CB Antibody (269020)
(5 Publications)
Species: Hu
Applications: WB
PI 3-Kinase p110
gamma Antibody
NBP2-15071
Western Blot PI 3-Kinase p110 gamma Antibody
Western Blot PI 3-Kinase p110 gamma Antibody
Immunohistochemistry-Paraffin PI 3-Kinase p110 gamma Antibody
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
PI 3-Kinase p110
delta Antibody (27514 ...
MAB2687
Western Blot PI 3-Kinase p110 delta Antibody (275144)
Western Blot PI 3-Kinase p110 delta Antibody (275144)
(3 Publications)
Species: Hu
Applications: WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(25 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Sin1/MAPKAP1
Antibody
NB110-40424
Western Blot Sin1/MAPKAP1 Antibody
Immunohistochemistry-Paraffin Sin1/MAPKAP1 Antibody
Western Blot Sin1/MAPKAP1 Antibody
(7 Publications)
Species: Hu
Applications: IHC, IHC-P, IP, WB
PYK2/FAK2 Antibody
NBP3-12969
Western Blot PYK2/FAK2 Antibody
Immunocytochemistry/ Immunofluorescence PYK2/FAK2 Antibody
Immunoprecipitation PYK2/FAK2 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
AMPK alpha 2
Antibody [Unconjugate
AF2850
Western Blot AMPK alpha 2 Antibody [Unconjugated]
Simple Western AMPK alpha 2 Antibody [Unconjugated]
Immunocytochemistry AMPK alpha 2 Antibody [Unconjugated]
(11 Publications)
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
4EBP1 Antibody
NB200-157
Western Blot 4EBP1 Antibody
Western Blot 4EBP1 Antibody
Western Blot 4EBP1 Antibody
(45 Publications)
Species: Hu
Applications: IHC, IHC-P, KO, WB
AMPK alpha 1
Antibody (2B7) - BSA
NBP2-22127
Flow Cytometry AMPK alpha 1 Antibody (2B7) - BSA Free
Flow Cytometry AMPK alpha 1 Antibody (2B7) - BSA Free
ELISA AMPK alpha 1 Antibody (2B7) - BSA Free
(12 Publications)
Species: Hu, Mu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
AMPK beta 1
Antibody [Unconjugate
AF2854
Western Blot AMPK beta 1 Antibody [Unconjugated]
Immunohistochemistry AMPK beta 1 Antibody [Unconjugated]
Immunohistochemistry AMPK beta 1 Antibody [Unconjugated]
(2 Publications)
Species: Hu, Mu, Rt
Applications: IHC, WB
p70 S6 Kinase/S6K
Antibody [Unconjugate ...
AF8962
Western Blot p70 S6 Kinase/S6K Antibody [Unconjugated]
Simple Western p70 S6 Kinase/S6K Antibody [Unconjugated]
Immunohistochemistry p70 S6 Kinase/S6K Antibody [Unconjugated]
(6 Publications)
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
TORC2 Recombinant
Protein Antigen
NBP1-86925PEP
TORC2 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for TORC2 Protein (NBP1-86925PEP) (0)

There are no publications for TORC2 Protein (NBP1-86925PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TORC2 Protein (NBP1-86925PEP) (0)

There are no reviews for TORC2 Protein (NBP1-86925PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TORC2 Protein (NBP1-86925PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TORC2 Products

Research Areas for TORC2 Protein (NBP1-86925PEP)

Find related products by research area.

Blogs on TORC2

There are no specific blogs for TORC2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TORC2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol CRTC2