Home » TLE2 » TLE2 Proteins » TLE2 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

TLE2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for TLE2 Protein (NBP2-13435PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

TLE2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TLE2.

Source: E. coli

Amino Acid Sequence: SDYNLVVDEDQPSEPPSPATTPCGKVPICIPARRDLVDSPASLASSLGSP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TLE2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13435.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TLE2 Recombinant Protein Antigen

  • enhancer of split groucho 2
  • ESG
  • ESG2
  • ESG2Enhancer of split groucho-like protein 2
  • FLJ41188
  • GRG2
  • TLE2
  • transducin-like enhancer of split 2 (E(sp1) homolog, Drosophila)
  • transducin-like enhancer of split 2, homolog of Drosophila E(sp1)
  • transducin-like enhancer protein 2

Background

Transcriptional corepressor that binds to a number of transcription factors. Inhibits the transcriptional activation mediated by CTNNB1 and TCF family members in Wnt signaling. The effects of full-length TLE family members may be modulated by association with dominant-negative AES

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

TLE1 Antibody
(OTI1H2)
NBP2-46134
Flow Cytometry TLE1 Antibody (OTI1H2)
Immunofluorescence TLE1 Antibody (OTI1H2)
Immunohistochemistry TLE1 Antibody (OTI1H2)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
TLE4 Antibody
NBP2-15140
Immunocytochemistry/ Immunofluorescence TLE4 Antibody
Immunohistochemistry-Paraffin TLE4 Antibody
Western Blot TLE4 Antibody
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
TLE3 Antibody
(CL3573)
NBP2-61621
Immunohistochemistry-Paraffin TLE3 Antibody (CL3573)
Immunohistochemistry-Paraffin TLE3 Antibody (CL3573)
Immunohistochemistry-Paraffin TLE3 Antibody (CL3573)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Calbindin D-28K
Antibody
NBP2-50028
Western Blot Calbindin D-28K Antibody
Immunocytochemistry/ Immunofluorescence Calbindin D-28K Antibody
Western Blot Calbindin D-28K Antibody
(1 Review)
(13 Publications)
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-P, WB
TLE6 Antibody (2E4)
H00079816-M01
Western Blot TLE6 Antibody (2E4)
(1 Publication)
Species: Hu
Applications: ELISA, ICC/IF, IHC, WB
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(650 Publications)
Species: Mu
Applications: ELISA
Osteopontin/OPN
Antibody [Unconjugate
AF808
Immunocytochemistry Osteopontin/OPN Antibody [Unconjugated]
Neutralization Osteopontin/OPN Antibody [Unconjugated]
Immunohistochemistry Osteopontin/OPN Antibody [Unconjugated]
(2 Reviews)
(204 Publications)
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB
DPPA5/ESG1 Antibody
AF3125
DPPA5/ESG1 Antibody
(2 Publications)
Species: Hu
Applications: ICC, WB
RUNX1/CBFA2
Antibody
NBP1-89105
Immunocytochemistry/ Immunofluorescence RUNX1/CBFA2 Antibody
Immunohistochemistry-Paraffin RUNX1/CBFA2 Antibody
Immunohistochemistry-Paraffin RUNX1/CBFA2 Antibody
(1 Review)
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
HLF Antibody (M2)
H00003131-M04
Western Blot HLF Antibody (M2)
Immunocytochemistry/ Immunofluorescence HLF Antibody (M2)
Western Blot HLF Antibody (M2)
(1 Publication)
Species: Hu, Mu
Applications: ELISA, ICC/IF, KD, WB
Tenascin C
Antibody (4C8MS) - BS
NB110-68136
Flow Cytometry Tenascin C Antibody (4C8MS) - BSA Free
Immunocytochemistry/ Immunofluorescence Tenascin C Antibody (4C8MS) - BSA Free
Flow Cytometry Tenascin C Antibody (4C8MS) - BSA Free
(2 Reviews)
(26 Publications)
Species: Fe, Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
IBSP/Sialoprotein
II [Unconjugated]
4014-SP
Bioactivity IBSP/Sialoprotein II [Unconjugated]
(5 Publications)
Species: Hu
Applications: BA

beta-Galactosidase-1/G ...
NBP2-45731
Western Blot beta-Galactosidase-1/GLB1 Antibody (OTI1C9)
Immunohistochemistry beta-Galactosidase-1/GLB1 Antibody (OTI1C9)
Immunohistochemistry beta-Galactosidase-1/GLB1 Antibody (OTI1C9)
(6 Publications)
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
GNA11 Antibody
NBP1-98606
Western Blot GNA11 Antibody
Western Blot GNA11 Antibody
Western Blot GNA11 Antibody
Species: Hu, Mu
Applications: WB
HES-1 Antibody
(OTI4H1)
NBP1-47791
Western Blot HES-1 Antibody (OTI4H1)
Immunocytochemistry/ Immunofluorescence HES-1 Antibody (OTI4H1)
Immunocytochemistry/ Immunofluorescence HES-1 Antibody (OTI4H1)
(8 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
Oct-3/4 Antibody
[Unconjugated]
AF1759
Chromatin Immunoprecipitation (ChIP) Oct-3/4 Antibody [Unconjugated]
Immunocytochemistry Oct-3/4 Antibody [Unconjugated]
Simple Western Oct-3/4 Antibody [Unconjugated]
(75 Publications)
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
CDT2 Antibody
NB100-40840
Immunoprecipitation CDT2 Antibody
Western Blot CDT2 Antibody
Immunohistochemistry-Paraffin CDT2 Antibody
(1 Review)
(7 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
TLE2 Recombinant
Protein Antigen
NBP2-13435PEP
TLE2 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for TLE2 Protein (NBP2-13435PEP) (0)

There are no publications for TLE2 Protein (NBP2-13435PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TLE2 Protein (NBP2-13435PEP) (0)

There are no reviews for TLE2 Protein (NBP2-13435PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TLE2 Protein (NBP2-13435PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TLE2 Products

Research Areas for TLE2 Protein (NBP2-13435PEP)

Find related products by research area.

Blogs on TLE2

There are no specific blogs for TLE2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TLE2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol TLE2