![Western Blot: TKTL1 Antibody [NBP1-86939] - Analysis in control (vector only transfected HEK293T lysate) and TKTL1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/TKTL1-Antibody-Western-Blot-NBP1-86939-img0008.jpg "Western Blot: TKTL1 Antibody [NBP1-86939] - Analysis in control (vector only transfected HEK293T lysate) and TKTL1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SFSHPTSCSSSSEIMSVLFFYIMRYKQSDPENPDNDRFVLAKRLSFVDVATGWLGQGLGVACGMAYTGKYFDRASYRVFCLMSDGESS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TKTL1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | IHC-P reported in scientific literature (PMID: 25945836). For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
![Immunohistochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunohistochemistry_20892.jpg)
![Immunocytochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunocytochemistry__Immunofluorescence_21143.jpg)
![Western Blot EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Western_Blot_19925.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TKTL1 |
![Immunohistochemistry-Paraffin: TKTL1 Antibody [NBP1-86939] - Staining in human testis and endometrium tissues using anti-TKTL1 antibody. Corresponding TKTL1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/TKTL1-Antibody-Immunohistochemistry-Paraffin-NBP1-86939-img0007.jpg "Immunohistochemistry-Paraffin: TKTL1 Antibody [NBP1-86939] - Staining in human testis and endometrium tissues using anti-TKTL1 antibody. Corresponding TKTL1 RNA-seq data are presented for the same tissues.")
![Western Blot: TKTL1 Antibody [NBP1-86939] - Analysis in human testis tissue.](http://images.novusbio.com/fullsize/TKTL1-Antibody-Western-Blot-NBP1-86939-img0003.jpg "Western Blot: TKTL1 Antibody [NBP1-86939] - Analysis in human testis tissue.")
![Immunohistochemistry-Paraffin: TKTL1 Antibody [NBP1-86939] - Staining of human endometrium shows low expression as expected.](http://images.novusbio.com/fullsize/TKTL1-Antibody-Immunohistochemistry-Paraffin-NBP1-86939-img0005.jpg "Immunohistochemistry-Paraffin: TKTL1 Antibody [NBP1-86939] - Staining of human endometrium shows low expression as expected.")
![Immunohistochemistry-Paraffin: TKTL1 Antibody [NBP1-86939] - Staining of human testis shows high expression.](http://images.novusbio.com/fullsize/TKTL1-Antibody-Immunohistochemistry-Paraffin-NBP1-86939-img0006.jpg "Immunohistochemistry-Paraffin: TKTL1 Antibody [NBP1-86939] - Staining of human testis shows high expression.")
![N/A C-Reactive Protein/CRP [Biotin]](https://images.novusbio.com/images2/DATA_CReactive_Protein_DY1707_ELISA_1701.jpg)
![Simple Western DDR2 Antibody [Unconjugated]](https://images.novusbio.com/images2/DDR2_AF2538_Simple_Western_16764.jpg)
![Knockdown Validated DDR2 Antibody [Unconjugated]](https://images.novusbio.com/images/af2538_human-ddr2-affinity-purified-polyclonal-ab-41202412405131.jpg)
![Western Blot DDR2 Antibody [Unconjugated]](https://images.novusbio.com/images/af2538_human-ddr2-affinity-purified-polyclonal-ab-41202412401261.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_871.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_872.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/VEGF_DVE00_ELISA_208.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")