![Western Blot: TIMM44 Antibody [NBP1-86941] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented](http://images.novusbio.com/fullsize/TIMM44-Antibody-Western-Blot-NBP1-86941-img0019.jpg "Western Blot: TIMM44 Antibody [NBP1-86941] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EVLRKKLGELTGTVKESLHEVSKSDLGRKIKEGVEEAAKTAKQSAESVSKGGEKLGRTAAFRALSQGVESVKKEIDDSVLGQTGPYRRPQRLRKRTEFAGDKF |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TIMM44 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot RFC1 Antibody [Unconjugated]](https://images.novusbio.com/images2/RFC1_AF6457_Western_Blot_9874.jpg)
| Publication using NBP1-86941 | Applications | Species |
|---|---|---|
| Desmurs M, Foti M, Raemy E et al. C11orf83, a Mitochondrial Cardiolipin-Binding Protein Involved in bc1 Complex Assembly and Supercomplex Stabilization. Mol Cell Biol 2015-04-01 [PMID: 25605331] (WB, Human) | WB | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for TIMM44 Antibody (NBP1-86941)Find related products by research area.
|
|
New Players in the Mitophagy Game By Christina Towers, PhD Mitochondrial turn over via the lysosome, otherwise known as mitophagy, involves engulfment of mitochondria into double membrane autophagosomes and subsequent fusion with lysosomes. Much is al... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TIMM44 |
![Immunocytochemistry/Immunofluorescence: TIMM44 Antibody [NBP1-86941] - Staining of human cell line A-431 shows localization to mitochondria. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/TIMM44-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-86941-img0010.jpg "Immunocytochemistry/Immunofluorescence: TIMM44 Antibody [NBP1-86941] - Staining of human cell line A-431 shows localization to mitochondria. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: TIMM44 Antibody [NBP1-86941] - Staining of human gastrointestinal shows moderate to strong granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/TIMM44-Antibody-Immunohistochemistry-Paraffin-NBP1-86941-img0017.jpg "Immunohistochemistry-Paraffin: TIMM44 Antibody [NBP1-86941] - Staining of human gastrointestinal shows moderate to strong granular cytoplasmic positivity in glandular cells.")
![Western Blot: TIMM44 Antibody [NBP1-86941] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/TIMM44-Antibody-Western-Blot-NBP1-86941-img0009.jpg "Western Blot: TIMM44 Antibody [NBP1-86941] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Western Blot: TIMM44 Antibody [NBP1-86941] - Analysis in Caco-2 cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading control: Anti-PPIB.](http://images.novusbio.com/fullsize/TIMM44-Antibody-Western-Blot-NBP1-86941-img0016.jpg "Western Blot: TIMM44 Antibody [NBP1-86941] - Analysis in Caco-2 cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading control: Anti-PPIB.")
![Western Blot: TIMM44 Antibody [NBP1-86941] - Analysis in human cell lines PC-3 and HeLa. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.](http://images.novusbio.com/fullsize/TIMM44-Antibody-Western-Blot-NBP1-86941-img0014.jpg "Western Blot: TIMM44 Antibody [NBP1-86941] - Analysis in human cell lines PC-3 and HeLa. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.")
![Immunohistochemistry-Paraffin: TIMM44 Antibody [NBP1-86941] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.](http://images.novusbio.com/fullsize/TIMM44-Antibody-Immunohistochemistry-Paraffin-NBP1-86941-img0011.jpg "Immunohistochemistry-Paraffin: TIMM44 Antibody [NBP1-86941] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.")
![Immunohistochemistry-Paraffin: TIMM44 Antibody [NBP1-86941] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/TIMM44-Antibody-Immunohistochemistry-Paraffin-NBP1-86941-img0012.jpg "Immunohistochemistry-Paraffin: TIMM44 Antibody [NBP1-86941] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: TIMM44 Antibody [NBP1-86941] - Staining of human heart muscle shows strong cytoplasmic positivity in cardiomyocytes.](http://images.novusbio.com/fullsize/TIMM44-Antibody-Immunohistochemistry-Paraffin-NBP1-86941-img0013.jpg "Immunohistochemistry-Paraffin: TIMM44 Antibody [NBP1-86941] - Staining of human heart muscle shows strong cytoplasmic positivity in cardiomyocytes.")
![Western Blot TIM-1/KIM-1/HAVCR Antibody [Unconjugated]](https://images.novusbio.com/images2/TIM1_AF1817_Western_Blot_17317.jpg)
![Western Blot TIM-1/KIM-1/HAVCR Antibody [Unconjugated]](https://images.novusbio.com/images/af1817_mouse-tim-1-kim-1-havcr-affinity-purified-polyclonal-ab-4120241049450.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")