![Western Blot: TDO2 Antibody [H00006999-B01P] - Specificity of antibodies for tryptophan 2,3-dioxygenase (TDO) by Western blot. The total protein (20 ug) of the dentate gyrus, extracted from the wild-type (lanes 1 and 3) and Tdo-/- mice (lane 2), was subjected to 4% to 12% gradient sodium dodecyl sulfate polyacrylamide gel electrophoresis, and transferred to polyvinylidene difluoride membranes. TDO was detected as described in the Methods section. Note that a 45-kDa band was detected with the anti-TDO antibody. The positions of molecular weight markers are shown on the left. Lane 3: negative control without the primary antibody. beta-Tubulin is a positive control for the Western blot. Image collected and cropped by CiteAb from the following publication (//molecularbrain.biomedcentral.com/articles/10.1186/1756-6606-3-26), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/TDO2-Antibody-Western-Blot-H00006999-B01P-img0006.jpg "Western Blot: TDO2 Antibody [H00006999-B01P] - Specificity of antibodies for tryptophan 2,3-dioxygenase (TDO) by Western blot. The total protein (20 ug) of the dentate gyrus, extracted from the wild-type (lanes 1 and 3) and Tdo-/- mice (lane 2), was subjected to 4% to 12% gradient sodium dodecyl sulfate polyacrylamide gel electrophoresis, and transferred to polyvinylidene difluoride membranes. TDO was detected as described in the Methods section. Note that a 45-kDa band was detected with the anti-TDO antibody. The positions of molecular weight markers are shown on the left. Lane 3: negative control without the primary antibody. beta-Tubulin is a positive control for the Western blot. Image collected and cropped by CiteAb from the following publication (//molecularbrain.biomedcentral.com/articles/10.1186/1756-6606-3-26), licensed under a CC-BY license.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody reactive against mammalian transfected lysate. |
| Immunogen | TDO2 (NP_005642.1, 1 a.a. - 406 a.a.) full-length human protein. MSGCPFLGNNFGYTFKKLPVEGSEEDKSQTGVNRASKGGLIYGNYLHLEKVLNAQELQSETKGNKIHDEHLFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVVSRMHRVSVILKLLVQQFSILETMTALDFNDFREYLSPASGFQSLQFRLLENKIGVLQNMRVPYNRRHYRDNFKGEENELLLKSEQEKTLLELVEAWLERTPGLEPHGFNFWGKLEKNITRGLEEEFIRIQAKEESEEKEEQVAEFQKQKEVLLSLFDEKRHEHLLSKGERRLSYRALQGALMIYFYREEPRFQVPFQLLTSLMDIDSLMTKWRYNHVCMVHRMLGSKAGTGGSSGYHYLRSTVSDRYKVFVDLFNLSTYLIPRHWIPKMNPTIHKFLYTAEYCDSSYFSSDESD |
| Specificity | TDO2 - tryptophan 2,3-dioxygenase, |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | TDO2 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | IgG purified |
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for TDO2 Antibody (H00006999-B01P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TDO2 |
| Entrez |
|
| Uniprot |
|
![Western Blot: TDO2 Antibody [H00006999-B01P] - Analysis of TDO2 expression in transfected 293T cell line by TDO2 polyclonal antibody. Lane 1: TDO2 transfected lysate(44.66 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/TDO2-Antibody-Western-Blot-H00006999-B01P-img0005.jpg "Western Blot: TDO2 Antibody [H00006999-B01P] - Analysis of TDO2 expression in transfected 293T cell line by TDO2 polyclonal antibody. Lane 1: TDO2 transfected lysate(44.66 KDa). Lane 2: Non-transfected lysate.")
![Immunohistochemistry: TDO2 Antibody [H00006999-B01P] - Immunoreactivity of TDO in the SVZ, the olfactory bulb, and the cerebellum. In the cerebellum, the immunoreactivity for TDO was observed in granule cells and Purkinje cells of wild type mice, but these positive structures disappeared in Tdo-/- mice. The cytoarchitectural organization of Tdo-/- mice was the same as that of wild type mice. Image collected and cropped by CiteAb from the following publication (//molecularbrain.biomedcentral.com/articles/10.1186/1756-6606-3-26), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/TDO2-Antibody-Immunocytochemistry-Immunofluorescence-H00006999-B01P-img0009.jpg "Immunohistochemistry: TDO2 Antibody [H00006999-B01P] - Immunoreactivity of TDO in the SVZ, the olfactory bulb, and the cerebellum. In the cerebellum, the immunoreactivity for TDO was observed in granule cells and Purkinje cells of wild type mice, but these positive structures disappeared in Tdo-/- mice. The cytoarchitectural organization of Tdo-/- mice was the same as that of wild type mice. Image collected and cropped by CiteAb from the following publication (//molecularbrain.biomedcentral.com/articles/10.1186/1756-6606-3-26), licensed under a CC-BY license.")
![Western Blot: TDO2 Antibody [H00006999-B01P] - Analysis of TDO2 expression in human liver.](http://images.novusbio.com/fullsize/TDO2-Antibody-Western-Blot-H00006999-B01P-img0004.jpg "Western Blot: TDO2 Antibody [H00006999-B01P] - Analysis of TDO2 expression in human liver.")
![Immunohistochemistry: TDO2 Antibody [H00006999-B01P] - Immunoreactivity of TDO in the SVZ, the olfactory bulb, and the cerebellum. A TDO was not stained in the SVZ. The immunoreactivities for TDO in wild type and Tdo-/- mice were background level. Image collected and cropped by CiteAb from the following publication (//molecularbrain.biomedcentral.com/articles/10.1186/1756-6606-3-26), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/TDO2-Antibody-Immunocytochemistry-Immunofluorescence-H00006999-B01P-img0007.jpg "Immunohistochemistry: TDO2 Antibody [H00006999-B01P] - Immunoreactivity of TDO in the SVZ, the olfactory bulb, and the cerebellum. A TDO was not stained in the SVZ. The immunoreactivities for TDO in wild type and Tdo-/- mice were background level. Image collected and cropped by CiteAb from the following publication (//molecularbrain.biomedcentral.com/articles/10.1186/1756-6606-3-26), licensed under a CC-BY license.")
![Immunohistochemistry: TDO2 Antibody [H00006999-B01P] - Immunoreactivity of TDO in the SVZ, the olfactory bulb, and the cerebellum. TDO was not stained in the olfactory bulb (OB). The immunoreactivities for TDO in wild type and Tdo-/- mice were background level. Image collected and cropped by CiteAb from the following publication (//molecularbrain.biomedcentral.com/articles/10.1186/1756-6606-3-26), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/TDO2-Antibody-Immunocytochemistry-Immunofluorescence-H00006999-B01P-img0008.jpg "Immunohistochemistry: TDO2 Antibody [H00006999-B01P] - Immunoreactivity of TDO in the SVZ, the olfactory bulb, and the cerebellum. TDO was not stained in the olfactory bulb (OB). The immunoreactivities for TDO in wild type and Tdo-/- mice were background level. Image collected and cropped by CiteAb from the following publication (//molecularbrain.biomedcentral.com/articles/10.1186/1756-6606-3-26), licensed under a CC-BY license.")
![Immunohistochemistry: TDO2 Antibody [H00006999-B01P] - Specificity of antibodies for tryptophan 2,3-dioxygenase (TDO) by immunofluorescent staining. The hippocampal sections of wild-type and Tdo-/- mice were stained with anti-TDO antibody. In sections of Tdo -/- mice, immunofluorescence signals were not detected in granule cells, interneurons (arrowhead), CA1, or CA3 cells, suggesting that the secondary antibody used in this study bound specifically to the primary antibody (mouse IgG). g, granule cell layer; h, hilus. Image collected and cropped by CiteAb from the following publication (//molecularbrain.biomedcentral.com/articles/10.1186/1756-6606-3-26), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/TDO2-Antibody-Immunohistochemistry-H00006999-B01P-img0010.jpg "Immunohistochemistry: TDO2 Antibody [H00006999-B01P] - Specificity of antibodies for tryptophan 2,3-dioxygenase (TDO) by immunofluorescent staining. The hippocampal sections of wild-type and Tdo-/- mice were stained with anti-TDO antibody. In sections of Tdo -/- mice, immunofluorescence signals were not detected in granule cells, interneurons (arrowhead), CA1, or CA3 cells, suggesting that the secondary antibody used in this study bound specifically to the primary antibody (mouse IgG). g, granule cell layer; h, hilus. Image collected and cropped by CiteAb from the following publication (//molecularbrain.biomedcentral.com/articles/10.1186/1756-6606-3-26), licensed under a CC-BY license.")
![Immunocytochemistry/ Immunofluorescence: TDO2 Antibody [H00006999-B01P] - Immunoreactivity of TDO in the SVZ, the olfactory bulb, & the cerebellum. A & B: TDO was not stained in the SVZ (A) & the olfactory bulb (OB) (B). The immunoreactivities for TDO in wild type & Tdo-/- mice were background level. C: In the cerebellum, the immunoreactivity for TDO was observed in granule cells & Purkinje cells of wild type mice, but these positive structures disappeared in Tdo-/- mice. The cytoarchitectural organization of Tdo-/- mice was the same as that of wild type mice. E, external plexiform layer; G, granule cell layer; Gm, glomerular layer; I, internal plexiform layer; LV, lateral ventricle; Mi, mitral cell layer; Mo, molecular layer; P, Purkinje cell layer; St, striatum; Su, subependymal zone. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/20815922), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/h00006999-b01p_mouse-polyclonal-tdo2-antibody-310202415384127.jpg "Immunocytochemistry/ Immunofluorescence: TDO2 Antibody [H00006999-B01P] - Immunoreactivity of TDO in the SVZ, the olfactory bulb, & the cerebellum. A & B: TDO was not stained in the SVZ (A) & the olfactory bulb (OB) (B). The immunoreactivities for TDO in wild type & Tdo-/- mice were background level. C: In the cerebellum, the immunoreactivity for TDO was observed in granule cells & Purkinje cells of wild type mice, but these positive structures disappeared in Tdo-/- mice. The cytoarchitectural organization of Tdo-/- mice was the same as that of wild type mice. E, external plexiform layer; G, granule cell layer; Gm, glomerular layer; I, internal plexiform layer; LV, lateral ventricle; Mi, mitral cell layer; Mo, molecular layer; P, Purkinje cell layer; St, striatum; Su, subependymal zone. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/20815922), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Immunocytochemistry/ Immunofluorescence: TDO2 Antibody [H00006999-B01P] - Immunoreactivity of TDO in the SVZ, the olfactory bulb, & the cerebellum. A & B: TDO was not stained in the SVZ (A) & the olfactory bulb (OB) (B). The immunoreactivities for TDO in wild type & Tdo-/- mice were background level. C: In the cerebellum, the immunoreactivity for TDO was observed in granule cells & Purkinje cells of wild type mice, but these positive structures disappeared in Tdo-/- mice. The cytoarchitectural organization of Tdo-/- mice was the same as that of wild type mice. E, external plexiform layer; G, granule cell layer; Gm, glomerular layer; I, internal plexiform layer; LV, lateral ventricle; Mi, mitral cell layer; Mo, molecular layer; P, Purkinje cell layer; St, striatum; Su, subependymal zone. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/20815922), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/h00006999-b01p_mouse-polyclonal-tdo2-antibody-310202415171317.jpg "Immunocytochemistry/ Immunofluorescence: TDO2 Antibody [H00006999-B01P] - Immunoreactivity of TDO in the SVZ, the olfactory bulb, & the cerebellum. A & B: TDO was not stained in the SVZ (A) & the olfactory bulb (OB) (B). The immunoreactivities for TDO in wild type & Tdo-/- mice were background level. C: In the cerebellum, the immunoreactivity for TDO was observed in granule cells & Purkinje cells of wild type mice, but these positive structures disappeared in Tdo-/- mice. The cytoarchitectural organization of Tdo-/- mice was the same as that of wild type mice. E, external plexiform layer; G, granule cell layer; Gm, glomerular layer; I, internal plexiform layer; LV, lateral ventricle; Mi, mitral cell layer; Mo, molecular layer; P, Purkinje cell layer; St, striatum; Su, subependymal zone. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/20815922), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Immunocytochemistry/ Immunofluorescence: TDO2 Antibody [H00006999-B01P] - Immunoreactivity of TDO in the SVZ, the olfactory bulb, & the cerebellum. A & B: TDO was not stained in the SVZ (A) & the olfactory bulb (OB) (B). The immunoreactivities for TDO in wild type & Tdo-/- mice were background level. C: In the cerebellum, the immunoreactivity for TDO was observed in granule cells & Purkinje cells of wild type mice, but these positive structures disappeared in Tdo-/- mice. The cytoarchitectural organization of Tdo-/- mice was the same as that of wild type mice. E, external plexiform layer; G, granule cell layer; Gm, glomerular layer; I, internal plexiform layer; LV, lateral ventricle; Mi, mitral cell layer; Mo, molecular layer; P, Purkinje cell layer; St, striatum; Su, subependymal zone. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/20815922), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/h00006999-b01p_mouse-polyclonal-tdo2-antibody-310202415394527.jpg "Immunocytochemistry/ Immunofluorescence: TDO2 Antibody [H00006999-B01P] - Immunoreactivity of TDO in the SVZ, the olfactory bulb, & the cerebellum. A & B: TDO was not stained in the SVZ (A) & the olfactory bulb (OB) (B). The immunoreactivities for TDO in wild type & Tdo-/- mice were background level. C: In the cerebellum, the immunoreactivity for TDO was observed in granule cells & Purkinje cells of wild type mice, but these positive structures disappeared in Tdo-/- mice. The cytoarchitectural organization of Tdo-/- mice was the same as that of wild type mice. E, external plexiform layer; G, granule cell layer; Gm, glomerular layer; I, internal plexiform layer; LV, lateral ventricle; Mi, mitral cell layer; Mo, molecular layer; P, Purkinje cell layer; St, striatum; Su, subependymal zone. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/20815922), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: TDO2 Antibody [H00006999-B01P] - Specificity of antibodies for tryptophan 2,3-dioxygenase (TDO) by Western blot (A) & immunofluorescent staining (B). A: The total protein (20 μg) of the dentate gyrus, extracted from the wild-type (lanes 1 & 3) & Tdo-/- mice (lane 2), was subjected to 4% to 12% gradient sodium dodecyl sulfate polyacrylamide gel electrophoresis, & transferred to polyvinylidene difluoride membranes. TDO was detected as described in the Methods section. Note that a 45-kDa band was detected with the anti-TDO antibody. The positions of molecular weight markers are shown on the left. Lane 3: negative control without the primary antibody. beta -Tubulin is a positive control for the Western blot. B: The hippocampal sections of wild-type & Tdo-/- mice were stained with anti-TDO antibody. In sections of Tdo-/- mice, immunofluorescence signals were not detected in granule cells, interneurons (arrowhead), CA1, or CA3 cells, suggesting that the secondary antibody used in this study bound specifically to the primary antibody (mouse IgG). g, granule cell layer; h, hilus. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/20815922), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/h00006999-b01p_mouse-polyclonal-tdo2-antibody-310202415483615.jpg "Western Blot: TDO2 Antibody [H00006999-B01P] - Specificity of antibodies for tryptophan 2,3-dioxygenase (TDO) by Western blot (A) & immunofluorescent staining (B). A: The total protein (20 μg) of the dentate gyrus, extracted from the wild-type (lanes 1 & 3) & Tdo-/- mice (lane 2), was subjected to 4% to 12% gradient sodium dodecyl sulfate polyacrylamide gel electrophoresis, & transferred to polyvinylidene difluoride membranes. TDO was detected as described in the Methods section. Note that a 45-kDa band was detected with the anti-TDO antibody. The positions of molecular weight markers are shown on the left. Lane 3: negative control without the primary antibody. beta -Tubulin is a positive control for the Western blot. B: The hippocampal sections of wild-type & Tdo-/- mice were stained with anti-TDO antibody. In sections of Tdo-/- mice, immunofluorescence signals were not detected in granule cells, interneurons (arrowhead), CA1, or CA3 cells, suggesting that the secondary antibody used in this study bound specifically to the primary antibody (mouse IgG). g, granule cell layer; h, hilus. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/20815922), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Immunohistochemistry: TDO2 Antibody [H00006999-B01P] - Specificity of antibodies for tryptophan 2,3-dioxygenase (TDO) by Western blot (A) & immunofluorescent staining (B). A: The total protein (20 μg) of the dentate gyrus, extracted from the wild-type (lanes 1 & 3) & Tdo-/- mice (lane 2), was subjected to 4% to 12% gradient sodium dodecyl sulfate polyacrylamide gel electrophoresis, & transferred to polyvinylidene difluoride membranes. TDO was detected as described in the Methods section. Note that a 45-kDa band was detected with the anti-TDO antibody. The positions of molecular weight markers are shown on the left. Lane 3: negative control without the primary antibody. beta -Tubulin is a positive control for the Western blot. B: The hippocampal sections of wild-type & Tdo-/- mice were stained with anti-TDO antibody. In sections of Tdo-/- mice, immunofluorescence signals were not detected in granule cells, interneurons (arrowhead), CA1, or CA3 cells, suggesting that the secondary antibody used in this study bound specifically to the primary antibody (mouse IgG). g, granule cell layer; h, hilus. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/20815922), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/h00006999-b01p_mouse-polyclonal-tdo2-antibody-310202415485113.jpg "Immunohistochemistry: TDO2 Antibody [H00006999-B01P] - Specificity of antibodies for tryptophan 2,3-dioxygenase (TDO) by Western blot (A) & immunofluorescent staining (B). A: The total protein (20 μg) of the dentate gyrus, extracted from the wild-type (lanes 1 & 3) & Tdo-/- mice (lane 2), was subjected to 4% to 12% gradient sodium dodecyl sulfate polyacrylamide gel electrophoresis, & transferred to polyvinylidene difluoride membranes. TDO was detected as described in the Methods section. Note that a 45-kDa band was detected with the anti-TDO antibody. The positions of molecular weight markers are shown on the left. Lane 3: negative control without the primary antibody. beta -Tubulin is a positive control for the Western blot. B: The hippocampal sections of wild-type & Tdo-/- mice were stained with anti-TDO antibody. In sections of Tdo-/- mice, immunofluorescence signals were not detected in granule cells, interneurons (arrowhead), CA1, or CA3 cells, suggesting that the secondary antibody used in this study bound specifically to the primary antibody (mouse IgG). g, granule cell layer; h, hilus. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/20815922), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Bioactivity IFN-gamma [Unconjugated]](https://images.novusbio.com/images2/IFNgamma_285IF_2848.jpg)
![SDS-PAGE IFN-gamma [Unconjugated]](https://images.novusbio.com/images2/IFN-gamma_285-IF_230.jpg)
![SEC-MALS IFN-gamma [Unconjugated]](https://images.novusbio.com/images/285-if_recombinant-human-ifn-gamma-protein-sec-mals-1520239228..jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Immunocytochemistry Glucagon Antibody (181402) [Unconjugated]](https://images.novusbio.com/images2/Glucagon_MAB1249_Immunocytochemistry_6560.jpg)
![Intracellular Staining by Flow Cytometry Glucagon Antibody (181402) [Unconjugated]](https://images.novusbio.com/images2/Glucagon_MAB1249_Flow_Cytometry_20264.jpg)
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")