Reactivity | Hu, Mu, RtSpecies Glossary |
Applications | ICC/IF, IHC, KD, Single-Cell Western |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: HGIIGPSHNGAMGGLGSGYGTGLLSANRHSLMVGTHREDGVALRGSHSLLPNQVPVPQLPVQSATSPDLNPPQDPYRGMPPGLQGQSVSSGSSEIKSDDEGDENLQD |
Predicted Species | Rat (98%). Backed by our 100% Guarantee. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | TCF4 |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
Control Peptide |
|
||
Reviewed Applications |
|
||
Publications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Immunogen affinity purified |
Publications using NBP1-88633 | Applications | Species |
---|---|---|
Saegusa M, Hashimura M, Kuwata T et al. Sox4 functions as a positive regulator of Beta -catenin signaling through upregulation of TCF4 during morular differentiation of endometrial carcinomas. Lab Invest 2012-04-01 [PMID: 22231735] | ||
Tauil LH, Mader AMA, Tauil TH, Pires A. Immunohistochemistry expression of TCF4 protein on carcinoma, adenoma and non neoplastic colorectal mucosa. Journal of Coloproctology 2014-02-04 (IHC-P, Human) | IHC-P | Human |
Kuo T, Damle M, Gonzalez BJ et al. Mesenchymal Stromal Cells Are Required for Regeneration and Homeostatic Maintenance of Skeletal Muscle Cell Rep 2019-05-14 [PMID: 31091443] (Single Cell Western, KD, ICC/IF, Mouse) | Single Cell Western, KD, ICC/IF | Mouse |
Images | Ratings | Applications | Species | Date | Details | ||||||
---|---|---|---|---|---|---|---|---|---|---|---|
![]() Enlarge |
reviewed by:
yidong wang |
IHC | Mouse | 05/03/2017 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for TCF4 Antibody (NBP1-88633)Find related products by research area.
|
Beta Catenin in Cell Adhesion and T-cell Signaling Beta Catenin is a cytosolic, 88 kDa intracellular protein that tightly associates with cell surface cadherin glycoproteins. It is one member of the catenin family that includes alpha Catenin, beta Catenin, and gamma Catenin. Colocalization studies usi... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.