TBX5 Antibody (1G10) Summary
Description |
Quality control test: Antibody Reactive Against Recombinant Protein. |
Immunogen |
TBX5 (AAH27942, 402 a.a. ~ 518 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PSMPSYSSCTVTTVQPMDRLPYQHFSAHFTSGPLVPRLAGMANHGSPQLGEGMFQHQTSVAHQPVVRQCGPQTGLQSPGTLQPPEFLYSHGVPRTLSPHQYHSVHGVGMVPEWSDNS |
Specificity |
TBX5 - T-box 5 |
Isotype |
IgG1 Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
TBX5 |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence
- Knockdown Validated
- Western Blot
|
Application Notes |
Antibody reactivity against recombinant protein for WB. It has been used for RNAi Validation and ELISA. |
Publications |
|
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for TBX5 Antibody (1G10)
Background
This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This gene is closely linked to related family member T-box 3 (ulnar mammary syndrome) on human chromosome 12. The encoded protein may play a role in heart development and specification of limb identity. Mutations in this gene have been associated with Holt-Oram syndrome, a developmental disorder affecting the heart and upper limbs. Several transcript variants encoding different isoforms have been described for this gene.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA, BA
Species: Hu
Applications: BA
Species: Hu
Applications: WB
Species: Hu
Applications: ICC, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC
Species: Hu
Applications: BA
Species: Mu
Applications: BA
Species: Hu
Applications: ELISA, ICC/IF, KD, S-ELISA, WB
Species: Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, IP, KD, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC, Neut
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Fi, Pm
Applications: WB, ELISA, ICC/IF, KD
Publications for TBX5 Antibody (H00006910-M01)(6)
Showing Publications 1 -
6 of 6.
Publications using H00006910-M01 |
Applications |
Species |
L Drakhlis, S Biswanath, CM Farr, V Lupanow, J Teske, K Ritzenhoff, A Franke, F Manstein, E Bolesani, H Kempf, S Liebscher, K Schenke-La, J Hegermann, L Nolte, H Meyer, J de la Roch, S Thiemann, C Wahl-Schot, U Martin, R Zweigerdt Human heart-forming organoids recapitulate early heart and foregut development Nature Biotechnology, 2021-02-08;0(0):. 2021-02-08 [PMID: 33558697] |
|
|
Ghosh T, Aparicio-Sanchez J, Buxton S et al. HDAC4 and 5 repression of TBX5 is relieved by protein kinase D1. Sci Rep. 2019-11-29 [PMID: 31784580] |
|
|
Baban A, Pitto L, Pulignani S et al. Holt-Oram syndrome with intermediate atrioventricular canal defect, and aortic coarctation: Functional characterization of a de novo TBX5 mutation. Am J Med Genet A. 2014-03-24 [PMID: 24664498] |
|
|
Hartung S, Schwanke K, Haase A et al. Directing cardiomyogenic differentiation of human pluripotent stem cells by plasmid-based transient overexpression of cardiac transcription factors. Stem Cells Dev. 2013-01-18 [PMID: 23157212] |
|
|
Ghosh TK, Song FF, Packham EA et al. Physical interaction between TBX5 MEF2C is required for early heart development. Mol Cell Biol 29(8):2205-18. 2009-04-01 [PMID: 19204083] |
|
|
Halbert D, Domenyuk V, Spetzler D et al. Aptamers and uses thereof United States Patent Application US 9958448 B2 2018-01-01 |
|
|
Reviews for TBX5 Antibody (H00006910-M01) (0)
There are no reviews for TBX5 Antibody (H00006910-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for TBX5 Antibody (H00006910-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional TBX5 Products
Blogs on TBX5