Home » TAF4B » TAF4B Proteins » TAF4B Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

TAF4B Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for TAF4B Protein (NBP1-90657PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

TAF4B Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TAF4B.

Source: E. coli

Amino Acid Sequence: PHLVPFLKKSVVALRQLLPNSQSFIQQCVQQTSSDMVIATCTTTVTTSPVVTTTVSSSQSEKSIIVSGATAPRTVSVQTLNPLAGPVGAKAGVVTLHSVGPTAATGGTTAGTGLLQTSKPLVTSVANTVTTVSLQPEKPVVSGTAVT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TAF4B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90657.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TAF4B Recombinant Protein Antigen

  • TAF(II)105
  • TAF2C2
  • TAF4b RNA polymerase II, TATA box binding protein (TBP)-associated factor, 105kDa
  • TAFII105
  • TAFII-105
  • TATA box binding protein (TBP)-associated factor 4B
  • TATA box binding protein (TBP)-associated factor, RNA polymerase II, C2, 105kD
  • transcription initiation factor TFIID 105 kD subunit
  • transcription initiation factor TFIID 105 kDa subunit
  • transcription initiation factor TFIID subunit 4B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Recombinant Human
TATA binding protein ...
H00006908-Q01
SDS-PAGE Recombinant Human TATA binding protein TBP GST (N-Term) Protein
(5 Publications)
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
TAF8 Antibody
NBP2-38188
Immunocytochemistry/ Immunofluorescence TAF8 Antibody
Western Blot TAF8 Antibody
Immunohistochemistry-Paraffin TAF8 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
IGFBP-rp1/IGFBP-7
Antibody [Unconjugate ...
AF1334
Western Blot IGFBP-rp1/IGFBP-7 Antibody [Unconjugated]
Immunohistochemistry IGFBP-rp1/IGFBP-7 Antibody [Unconjugated]
(13 Publications)
Species: Hu
Applications: IHC, WB
Human, Mouse, Rat
RelA/NFkB p65 ELISA K ...
NBP2-29661
ELISA Human, Mouse, Rat RelA/NFkB p65 ELISA Kit (Colorimetric)
ELISA Human, Mouse, Rat RelA/NFkB p65 ELISA Kit (Colorimetric)
ELISA Human, Mouse, Rat RelA/NFkB p65 ELISA Kit (Colorimetric)
(95 Publications)
Species: Hu, Mu, Rt
Applications: ELISA
Taf4 Antibody
NBP1-80705
Immunocytochemistry/ Immunofluorescence Taf4 Antibody
Immunohistochemistry-Paraffin Taf4 Antibody
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Synaptotagmin 1
Antibody (ASV48) [Unc ...
MAB4364
Immunocytochemistry Synaptotagmin 1 Antibody (ASV48) [Unconjugated]
Immunohistochemistry Synaptotagmin 1 Antibody (ASV48) [Unconjugated]
Immunocytochemistry Synaptotagmin 1 Antibody (ASV48) [Unconjugated]
(1 Publication)
Species: Rt
Applications: ICC, IHC, IP, KO, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(809 Publications)
Species: Hu
Applications: BA
WNK1 Antibody
[Unconjugated]
AF2849
Western Blot WNK1 Antibody [Unconjugated]
(5 Publications)
Species: Mu, Rt
Applications: WB
GRASP65 Antibody
(OTI5G8)
NBP2-02665
Immunocytochemistry/ Immunofluorescence GRASP65 Antibody (OTI5G8)
Immunocytochemistry/ Immunofluorescence GRASP65 Antibody (OTI5G8)
Flow Cytometry GRASP65 Antibody (OTI5G8)
(3 Reviews)
(2 Publications)
Species: Ca, Hu, Pm, Po, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NFkB p105/p50
Antibody (2J10D7) - B ...
NB100-56583
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
(1 Review)
(5 Publications)
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
BOB1 Antibody
(BOB1/2424)
NBP2-75752
Immunohistochemistry-Paraffin BOB1 Antibody (BOB1/2424)
Western Blot BOB1 Antibody (BOB1/2424)
Flow Cytometry BOB1 Antibody (BOB1/2424)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PA, WB
c-jun [p Ser63]
Antibody (1018Y) [Unc ...
MAB8930
Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
SS18 Antibody
H00006760-B01P
Immunocytochemistry/ Immunofluorescence SS18 Antibody
Western Blot SS18 Antibody
Western Blot SS18 Antibody
Species: Hu
Applications: ICC/IF, WB
PLZF Antibody
[Unconjugated]
AF2944
Western Blot PLZF Antibody [Unconjugated]
Simple Western PLZF Antibody [Unconjugated]
Western Blot PLZF Antibody [Unconjugated]
(44 Publications)
Species: Hu
Applications: Simple Western, WB
Bcl-xL Antibody
NB100-56104
Western Blot Bcl-xL Antibody
Immunohistochemistry-Paraffin Bcl-xL Antibody
Western Blot Bcl-xL Antibody
(1 Review)
(3 Publications)
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
Dihydrofolate
Reductase/DHFR Antibo ...
H00001719-M01
Western Blot Dihydrofolate Reductase/DHFR Antibody (2B10)
Western Blot Dihydrofolate Reductase/DHFR Antibody (2B10)
Western Blot Dihydrofolate Reductase/DHFR Antibody (2B10)
(12 Publications)
Species: Hu, Mu, Rt, Ye
Applications: ELISA, ICC/IF, S-ELISA, WB
COCO/DAND5
[Unconjugated]
3047-CC
COCO/DAND5 [Unconjugated]
(4 Publications)
Species: Hu
Applications: BA
c-Myc Antibody
(9E10) - BSA Free
NB600-302
Flow Cytometry c-Myc Antibody (9E10) - BSA Free
Flow Cytometry c-Myc Antibody (9E10) - BSA Free
Western Blot c-Myc Antibody (9E10) - BSA Free
(4 Reviews)
(46 Publications)
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
CREB [p Ser133]
[Biotin]
DYC2510-2
N/A CREB [p Ser133] [Biotin]
N/A CREB [p Ser133] [Biotin]
N/A CREB [p Ser133] [Biotin]
(9 Publications)
Species: Hu, Mu, Rt
Applications: ELISA
TAF4B Recombinant
Protein Antigen
NBP1-90657PEP
TAF4B Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for TAF4B Protein (NBP1-90657PEP) (0)

There are no publications for TAF4B Protein (NBP1-90657PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TAF4B Protein (NBP1-90657PEP) (0)

There are no reviews for TAF4B Protein (NBP1-90657PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TAF4B Protein (NBP1-90657PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TAF4B Products

Array NBP1-90657PEP

Blogs on TAF4B

There are no specific blogs for TAF4B, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Flow Cytometry: c-Myc Antibody (9E10) [NB600-302] - An intracellular stain was performed on U-937 cells with c-Myc Antibody (9E10) NB600-302AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
c-Myc Antibody (9E10) - BSA Free
NB600-302

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TAF4B Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol TAF4B