Home » SUMO4 » SUMO4 Proteins » Recombinant Human SUMO4 GST (N-Term) Protein
Novus Biologicals products are now on bio-techne.com

Recombinant Human SUMO4 GST (N-Term) Protein

 Submit a Review

Images

 
(
Enlarge)
12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Novus Biologicals offers 100% Guarantee

Recombinant Human SUMO4 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-95 of Human SUMO4

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MANEKPTEEVKTENNNHINLKVAGQDGSVVQFKIKRQTPLSKLMKAYCEPRGLSVKQIRFRFGGQPISGTDKPAQLEMEDEDTIDVFQQPTGGVY
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
SUMO4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
37.1 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SUMO4 GST (N-Term) Protein

  • dJ281H8.4
  • IDDM5
  • small ubiquitin-like modifier 4 protein
  • Small ubiquitin-like protein 4
  • small ubiquitin-related modifier 4
  • SMT3 suppressor of mif two 3 homolog 2
  • SMT3 suppressor of mif two 3 homolog 4 (S. cerevisiae)
  • SMT3 suppressor of mif two 3 homolog 4 (yeast)
  • SMT3H4
  • SUMO4
  • SUMO-4

Background

This gene is a member of the SUMO gene family. This family of genes encode small ubiquitin-related modifiers that are attached to proteins and control the target proteins' subcellular localization, stability, or activity. The protein described in this record is located in the cytoplasm and specifically modifies IKBA, leading to negative regulation of NF-kappa-B-dependent transcription of the IL12B gene. A specific polymorphism in this SUMO gene, which leads to the M55V substitution, has been associated with type I diabetes. The RefSeq contains this polymorphism. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(25 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
CTLA-4
[Unconjugated]
7268-CT
Bioactivity CTLA-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
NFkB p105/p50
Antibody (2J10D7) - B ...
NB100-56583
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
(1 Review)
(5 Publications)
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
TAB2 Antibody
(HL1712) - Azide and ...
NBP3-25708
Western Blot TAB2 Antibody (HL1712) - Azide and BSA Free
Immunohistochemistry-Paraffin TAB2 Antibody (HL1712) - Azide and BSA Free
Western Blot TAB2 Antibody (HL1712) - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Lyp/PTPN22
Antibody [Unconjugate
AF3428
Western Blot Lyp/PTPN22 Antibody [Unconjugated]
Simple Western Lyp/PTPN22 Antibody [Unconjugated]
Immunocytochemistry Lyp/PTPN22 Antibody [Unconjugated]
(9 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
SUMO2/3 Antibody
(6R8G7)
NBP3-16540
Immunohistochemistry-Paraffin SUMO2/3 Antibody (6R8G7)
Immunohistochemistry-Paraffin SUMO2/3 Antibody (6R8G7)
Western Blot SUMO2/3 Antibody (6R8G7)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
HLA DQB1 Antibody
- Azide and BSA Free
NBP3-16006
Immunohistochemistry-Paraffin HLA DQB1 Antibody - Azide and BSA Free
Western Blot HLA DQB1 Antibody - Azide and BSA Free
Immunohistochemistry-Paraffin HLA DQB1 Antibody - Azide and BSA Free
Species: Hu
Applications: IHC, IHC-P, WB
CD25/IL-2R alpha
[HRP]
DR2A00
N/A CD25/IL-2R alpha [HRP]
N/A CD25/IL-2R alpha [HRP]
(36 Publications)
Species: Hu
Applications: ELISA
SUMO1 Antibody
(SM1/495)
NBP2-32901
Immunohistochemistry-Paraffin SUMO1 Antibody (SM1/495)
Flow Cytometry SUMO1 Antibody (SM1/495)
Immunocytochemistry/ Immunofluorescence SUMO1 Antibody (SM1/495)
(1 Review)
(2 Publications)
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
TEAD1 Antibody -
Azide and BSA Free
NBP2-94035
Chromatin Immunoprecipitation TEAD1 Antibody - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence TEAD1 Antibody - Azide and BSA Free
Western Blot TEAD1 Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
MHC Class I
Antibody (OX18) - BSA
NB120-6405
Flow Cytometry MHC Class I Antibody (OX18) - BSA Free
Immunocytochemistry/ Immunofluorescence MHC Class I Antibody (OX18) - BSA Free
Immunocytochemistry/ Immunofluorescence MHC Class I Antibody (OX18) - BSA Free
(37 Publications)
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
IL-12/IL-23 p40
[Biotin]
DY499
N/A IL-12/IL-23 p40 [Biotin]
(52 Publications)
Species: Mu
Applications: ELISA
OCTN1/SLC22A4
Antibody - Azide and ...
H00006583-A01
Western Blot OCTN1/SLC22A4 Antibody - Azide and BSA Free
(1 Review)
(3 Publications)
Species: Ca, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC-WhMt, IHC, IHC-Fr, WB
Neurofascin
Antibody
AF3235
Western Blot Neurofascin Antibody
Immunohistochemistry Neurofascin Antibody
Immunohistochemistry Neurofascin Antibody
(1 Review)
(33 Publications)
Species: Hu, Mu, Rt
Applications: IHC, WB
Recombinant Human
HLA DRB4 GST (N-Term) ...
H00003126-P01
Other Recombinant Human HLA DRB4 GST (N-Term) Protein
(1 Publication)
Species: Hu
Applications: ELISA, AP, PA, WB
PCMT1 Antibody -
BSA Free
NBP1-85806
Immunocytochemistry/ Immunofluorescence PCMT1 Antibody - BSA Free
Western Blot PCMT1 Antibody - BSA Free
Western Blot PCMT1 Antibody - BSA Free
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
FoxP3 Antibody -
BSA Free
NB100-39002
Flow Cytometry FoxP3 Antibody - BSA Free
Flow Cytometry FoxP3 Antibody - BSA Free
Immunohistochemistry-Paraffin FoxP3 Antibody - BSA Free
(2 Reviews)
(66 Publications)
Species: Bv, Hu, Mu, Rt
Applications: Dual ISH-IHC, Flow, IB, ICC/IF, IHC, IHC-P, IP, Single-Cell Western, WB
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free
(1 Review)
(26 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

Publications for SUMO4 Recombinant Protein (H00387082-P01) (0)

There are no publications for SUMO4 Recombinant Protein (H00387082-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SUMO4 Recombinant Protein (H00387082-P01) (0)

There are no reviews for SUMO4 Recombinant Protein (H00387082-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SUMO4 Recombinant Protein (H00387082-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SUMO4 Products

Array H00387082-P01

Research Areas for SUMO4 Recombinant Protein (H00387082-P01)

Find related products by research area.

Blogs on SUMO4

There are no specific blogs for SUMO4, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Flow Cytometry: FoxP3 Antibody [NB100-39002] - An intracellular stain was performed on MCF7 cells with FoxP3 Antibody NB100-39002PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Phycoerythrin.
FoxP3 Antibody - BSA Free
NB100-39002

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SUMO4 GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol SUMO4