![Immunohistochemistry-Paraffin: SR1 Antibody [NBP2-57990] - Staining of human cerebral cortex.](http://images.novusbio.com/fullsize/SR1-Antibody-Immunohistochemistry-Paraffin-NBP2-57990-img0008.jpg "Immunohistochemistry-Paraffin: SR1 Antibody [NBP2-57990] - Staining of human cerebral cortex.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LNGWRQHFISFDTDRSGTVDPQELQKALTTMGFRLSPQAVNSIAKRYSTNGKITFDDYI |
| Predicted Species | Mouse (93%), Rat (92%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SRI |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for SRI Antibody (NBP2-57990)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SRI |
![Immunohistochemistry-Paraffin: SR1 Antibody [NBP2-57990] - Staining of human rectum shows high expression.](http://images.novusbio.com/fullsize/SR1-Antibody-Immunohistochemistry-Paraffin-NBP2-57990-img0003.jpg "Immunohistochemistry-Paraffin: SR1 Antibody [NBP2-57990] - Staining of human rectum shows high expression.")
![Immunohistochemistry-Paraffin: SR1 Antibody [NBP2-57990] - Staining of human skeletal muscle shows low expression as expected.](http://images.novusbio.com/fullsize/SR1-Antibody-Immunohistochemistry-Paraffin-NBP2-57990-img0004.jpg "Immunohistochemistry-Paraffin: SR1 Antibody [NBP2-57990] - Staining of human skeletal muscle shows low expression as expected.")
![Immunohistochemistry-Paraffin: SR1 Antibody [NBP2-57990] - Staining in human rectum and skeletal muscle tissues using anti-SRI antibody. Corresponding SRI RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/SR1-Antibody-Immunohistochemistry-Paraffin-NBP2-57990-img0005.jpg "Immunohistochemistry-Paraffin: SR1 Antibody [NBP2-57990] - Staining in human rectum and skeletal muscle tissues using anti-SRI antibody. Corresponding SRI RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: SR1 Antibody [NBP2-57990] - Staining of human cerebral cortex, liver, rectum and skeletal muscle using Anti-SRI antibody NBP2-57990 (A) shows similar protein distribution across tissues to independent antibody NBP2-55404 (B).](http://images.novusbio.com/fullsize/SR1-Antibody-Immunohistochemistry-Paraffin-NBP2-57990-img0006.jpg "Immunohistochemistry-Paraffin: SR1 Antibody [NBP2-57990] - Staining of human cerebral cortex, liver, rectum and skeletal muscle using Anti-SRI antibody NBP2-57990 (A) shows similar protein distribution across tissues to independent antibody NBP2-55404 (B).")
![Immunohistochemistry-Paraffin: SR1 Antibody [NBP2-57990] - Staining of human liver.](http://images.novusbio.com/fullsize/SR1-Antibody-Immunohistochemistry-Paraffin-NBP2-57990-img0007.jpg "Immunohistochemistry-Paraffin: SR1 Antibody [NBP2-57990] - Staining of human liver.")
![Western Blot Annexin A7 Antibody [Unconjugated]](https://images.novusbio.com/images2/Annexin_A7_AF3926_Western_Blot_5364.jpg)
![Simple Western Annexin A7 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af3926_human-mouse-rat-annexin-a7-affinity-purified-polyclonal-ab-simple-western-7112024125536..jpg)
![SDS-PAGE LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_719.jpg)
![Bioactivity LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_721.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Immunocytochemistry Integrin alpha 2/CD49b Antibody (HAS3) [Unconjugated]](https://images.novusbio.com/images2/Integrin_alpha_2_MAB1233_Immunocytochemistry__Immunofluorescence_19196.jpg)
![Flow Cytometry Integrin alpha 2/CD49b Antibody (HAS3) [Unconjugated]](https://images.novusbio.com/images2/Integrin_alpha_2_MAB1233_Flow_Cytometry_19476.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")