SP140 Antibody (3F9) Summary
Immunogen |
SP140 (NP_009168.3, 504 a.a. ~ 612 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GHGWSRMRMRRQKNSQQNDNSKADGQVVSSEKKANVNLKDLSKIRGRKRGKPGTRFTQSDRAAQKRVRSRASRKHKDETVDFKAPLLPVTCGGVKGILHKKKLQQGILV |
Specificity |
SP140 - SP140 nuclear body protein (3F9) |
Isotype |
IgG2a Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
SP140 |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Sandwich ELISA
|
Application Notes |
This product is useful for ELISA. |
Publications |
|
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for SP140 Antibody (3F9)
Background
SP140 is a component of the nuclear body, also known as nuclear domain 10, PML oncogenic domain, and KR body. May be involved in the pathogenesis of acute promyelocytic leukemia and viral infection
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, Micro, WB
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, PLA, WB
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Mu
Applications: WB
Species: Hu
Applications: IHC, WB
Species: Mu
Applications: Block, WB
Species: Hu
Applications: IP, Neut, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: IHC, WB
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, IHC, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ChIP, ChIP, CyTOF-ready, Flow, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, KD, KO, WB
Species: Hu
Applications: IHC, IHC-P, WB
Publications for SP140 Antibody (H00011262-M07)(1)
Showing Publication 1 -
1 of 1.
Publication using H00011262-M07 |
Applications |
Species |
M Ghiboub, J Koster, PD Craggs, AYF Li Yim, A Shillings, S Hutchinson, RP Bingham, K Gatfield, IL Hageman, G Yao, HP O'Keefe, A Coffin, A Patel, LA Sloan, DJ Mitchell, TG Hayhow, L Lunven, RJ Watson, CE Blunt, LA Harrison, G Bruton, U Kumar, N Hamer, JR Spaull, DA Zwijnenbur, O Welting, TBM Hakvoort, AA Te Velde, J van Limber, P Henneman, RK Prinjha, MPJ de Winther, NR Harker, DF Tough, WJ de Jonge Modulation of macrophage inflammatory function through selective inhibition of the epigenetic reader protein SP140 Bmc Biology, 2022-08-19;20(1):182. 2022-08-19 [PMID: 35986286] |
|
|
Reviews for SP140 Antibody (H00011262-M07) (0)
There are no reviews for SP140 Antibody (H00011262-M07).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for SP140 Antibody (H00011262-M07) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional SP140 Products
Blogs on SP140