Novus Biologicals products are now on bio-techne.com

SOX2 Antibody (CL4716)

Images

 
Genetic Strategies: Western Blot: SOX2 Antibody (CL4716) [NBP2-59057] - Analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-SOX2 antibody. Remaining ...read more
Western Blot: SOX2 Antibody (CL4716) [NBP2-59057] - Analysis in human cell line NTERA-2.
Immunocytochemistry/ Immunofluorescence: SOX2 Antibody (CL4716) [NBP2-59057] - Staining of U-251 cells using the anti-SOX2 monoclonal antibody, showing specific staining in the nucleoplasm in green. Microtubule- and ...read more
Immunohistochemistry-Paraffin: SOX2 Antibody (CL4716) [NBP2-59057] - Staining of human placenta shows no positivity as expected (negative control).
Immunohistochemistry: SOX2 Antibody (CL4716) [NBP2-59057] - SOX2 Antibody [NBP2-59057] - Staining of mouse embryo E11 shows nuclear immunoreactivity in the developing brain, eye and trigeminal ganglion.
Immunohistochemistry: SOX2 Antibody (CL4716) [NBP2-59057] - SOX2 Antibody [NBP2-59057] - Staining of mouse embryo E11 shows nuclear immunoreactivity in the developing neural tube.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, KD
Clone
CL4716
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

SOX2 Antibody (CL4716) Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GSYSMMQDQLGYPQHPGLNAHGAAQMQPMHRYDVSALQYNSMTSSQTYMNGSPTYSMSYSQQGTPGMALGSM
Epitope
GYPQHPGLNA
Predicted Species
Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG1
Clonality
Monoclonal
Host
Mouse
Gene
SOX2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 2-10 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Knockdown Validated
  • Western Blot 1 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SOX2 Recombinant Protein Antigen (NBP2-59057PEP)

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Mouse-On-Mouse blocking reagent may be needed for IHC and ICC experiments to reduce high background signal. You can find these reagents under catalog numbers PK-2200-NB and MP-2400-NB. Please contact Technical Support if you have any questions

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for SOX2 Antibody (CL4716)

  • ANOP3
  • MCOPS3
  • MGC2413
  • SOX2
  • SRY (sex determining region Y)-box 2
  • SRY-related HMG-box gene 2
  • transcription factor SOX2
  • transcription factor SOX-2

Background

The SOX-2 protein is a transcription factor that is critical for early embryogenesis and for embryonic stem cell pluripotency. The SOX-2 protein is also significant for eye development. SOX 2, also known as SRY related HMG BOX gene 2, belongs to the SOX (SRY-box containing gene) gene family. The SOX-2 protein is a transcription factor since it binds to DNA and regulates activity of other genes. All SOX family proteins share HMG box domains for DNA binding.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1759
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
AF1997
Species: Hu
Applications: ChIP, ICC, IHC, Simple Western, WB
H00388112-B01P
Species: Hu
Applications: WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
AF3158
Species: Mu
Applications: ChIP, ICC, IHC, WB
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB1259
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
AF3757
Species: Hu
Applications: ICC, Simple Western, WB
7734-LF
Species: Hu
Applications: BA
NB300-141
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
AF8150
Species: Hu
Applications: ICC, ICFlow, Simple Western, WB
235-F4
Species: Hu
Applications: BA
NBP2-37357
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
AF2569
Species: Hu
Applications: ICC, WB
233-FB
Species: Hu
Applications: BA
NB120-16518
Species: Hu, Mu, Po, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
314-BP
Species: Hu
Applications: BA, BA
NBP2-59057
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, KD

Publications for SOX2 Antibody (NBP2-59057) (0)

There are no publications for SOX2 Antibody (NBP2-59057).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SOX2 Antibody (NBP2-59057) (0)

There are no reviews for SOX2 Antibody (NBP2-59057). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SOX2 Antibody (NBP2-59057) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SOX2 Products

Research Areas for SOX2 Antibody (NBP2-59057)

Find related products by research area.

Blogs on SOX2. Showing 1-10 of 13 blog posts - Show all blog posts.

Spheroids vs. Organoids: Which 3D Cell Culture Model is Best for You?
By Jennifer Jones, M.S.Spheroids and organoids are two words that, like “butter” and “margarine”, are often referred to interchangeably but have distinct meanings. The progression and adopt...  Read full blog post.


  Read full blog post.

Breast cancer stem cells survive chemotherapy through S100A10-ANXA2-SPT6 interaction that epigenetically promotes OCT4-mediated stemness
By Jamshed Arslan, Pharm D, PhDBreast cancer is the most common cancer among women that causes the greatest number of cancer-related deaths worldwide. After radiotherapy or cytotoxic chemotherapy like paclitax...  Read full blog post.

Deriving neural precursor cells from human induced pluripotent stem cells
By Jennifer Sokolowski, MD, PhD.Human induced pluripotent stem cells (iPSCs) can be used to create models of human organ systems and are useful for a) ascertaining the mechanisms underlying pathological conditions...  Read full blog post.

Application Focus: New Methods for iPSC Differentiation, Inducing a Mammary Fate
Discovery of the Key to PluripotencyInduced pluripotent stem cells (iPSCs) may be generated from a wide range of fully differentiated cells, and under optimal conditions may be prompted to differentiate into virtu...  Read full blog post.

Stemness for Surviving Hypoxia: TGF-beta/Smad Signaling in Multiple Myeloma
By Jamshed Arslan Pharm.D. Multiple myeloma (MM) is a cancer of antibody-producing plasma cells. The bone marrow (BM) of MM patients is hypoxic, and MM cells overexpress many cancerous genes that are regulated by hy...  Read full blog post.

KLF4 as a transcription factor in stem cell differentiation
Kru¨ppel-like factors (KLFs) are evolutionarily conserved zinc finger transcription factors that play a role in cell differentiation, proliferation, and pluripotency. KLF4 has specifically been tied to many diverse cellular processes, including sel...  Read full blog post.

SOX2 - a stem cell transcription factor
The SOX gene family encodes a group of highly conserved transcription factors defined by the presence of a conserved high motility group (HMG) DNA-binding domain. They are involved in embryonic development regulation and cell fate determination. Al...  Read full blog post.

SOX2: an Important Stem Cell Transcription Factor
SOX2 is a transcription factor that is expressed by self-renewing and multipotent stem cells of the embryonic neuroepithelium. Sox-2 was found to be expressed by dividing neural progenitor cells. Constitutive expression of SOX2 has also been shown to ...  Read full blog post.

Sox2 and Oct4: Roles in Embryonic Stem Cell Pluripotency
Embryonic stem (ES) cells are cells derived from the inner cell mass of the blastocyst, an early-stage embryo. ES cells are distinguished from other cells due to their pluripotency, which is the ability to differentiate into any different type of cell...  Read full blog post.

Showing 1-10 of 13 blog posts - Show all blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SOX2 Antibody (CL4716) and receive a gift card or discount.

Bioinformatics

Gene Symbol SOX2