![Western Blot: SOHLH2 Antibody [H00054937-B01P] - Analysis of SOHLH2 expression in transfected 293T cell line by SOHLH2 polyclonal antibody. Lane 1: TEB1 transfected lysate(24.75 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/SOHLH2-Antibody-Western-Blot-H00054937-B01P-img0002.jpg "Western Blot: SOHLH2 Antibody [H00054937-B01P] - Analysis of SOHLH2 expression in transfected 293T cell line by SOHLH2 polyclonal antibody. Lane 1: TEB1 transfected lysate(24.75 KDa). Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | TEB1 (AAH25383.1, 1 a.a. - 225 a.a.) full-length human protein. MASSIICQEHCQISGQAKIDILLVGDVTVGYLADTVQKLFANIAEVTITISDTKEAAALLDDCIFNMVLLKVPSSLSAEELEAIKLIRFGKKKNTHSLFVFIIPENFKGCISGHGMDIALTEPLTMEKMSNVVKYWTTCPSNTVKTENATGPEELGLPLQRSYSEHLGYFPTDLFACSESLRNGNGLELNASLSEFEKNKKISLLHSSKEKLRRLYRKHSSFCFW |
| Specificity | TEB1 - hypothetical protein FLJ20449, |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | SOHLH2 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
![Simple Western CD117/c-kit Antibody [Unconjugated]](https://images.novusbio.com/images2/CD117_AF1356_Simple_Western_17480.jpg)
![Western Blot CD117/c-kit Antibody [Unconjugated]](https://images.novusbio.com/images2/CD117_AF1356_Western_Blot_18637.jpg)
![Immunohistochemistry CD117/c-kit Antibody [Unconjugated]](https://images.novusbio.com/images2/SCF_R_AF1356_Immunohistochemistry_9746.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for SOHLH2 Antibody (H00054937-B01P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SOHLH2 |
| Entrez |
|
| Uniprot |
|
![Bioactivity GDF-9 [Unconjugated]](https://images.novusbio.com/images2/GDF9_739G9CF_1211.jpg)
![SDS-PAGE CXCL12/SDF-1 alpha [Unconjugated]](https://images.novusbio.com/images2/CXCL12_SDF-1_alpha_350-NS_308.jpg)
![Bioactivity CXCL12/SDF-1 alpha [Unconjugated]](https://images.novusbio.com/images2/CXCL12SDF1_alpha_350NS_1178.jpg)
![Chromatin Immunoprecipitation (ChIP) Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct-3_4_AF1759_Chromatin_Immunoprecipitation_11218.jpg)
![Immunocytochemistry Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct-3_4_AF1759_Immunocytochemistry_7093.jpg)
![Simple Western Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct3_4_AF1759_Simple_Western_20183.jpg)
![Immunohistochemistry GFR alpha-1/GDNF R alpha-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/GFR_alpha1_AF560_Immunohistochemistry_17364.jpg)
![Western Blot GFR alpha-1/GDNF R alpha-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/GFR_alpha-1_AF560_Western_Blot_12576.jpg)
![Immunocytochemistry/ Immunofluorescence GFR alpha-1/GDNF R alpha-1 Antibody [Unconjugated]](https://images.novusbio.com/images/af560_rat-gfr-alpha-1-gdnf-r-alpha-1-affinity-purified-pab-8220249505912.jpg)
![Immunohistochemistry CXCR4 Antibody (44716) [Unconjugated]](https://images.novusbio.com/images2/CXCR4_MAB172_Immunohistochemistry_6955.jpg)
![Neutralization CXCR4 Antibody (44716) [Unconjugated]](https://images.novusbio.com/images2/CXCR4_MAB172_Block_Neutralize_9041.jpg)
![Immunohistochemistry CXCR4 Antibody (44716) [Unconjugated]](https://images.novusbio.com/images2/CXCR4_MAB172_Immunohistochemistry_19917.jpg)
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")