![Immunocytochemistry/Immunofluorescence: Sodium Potassium ATPase Alpha 1 Antibody (3L6F0) [NBP3-15427] - Immunofluorescence analysis of NIH-3T3 cells using Sodium Potassium ATPase Alpha 1 Rabbit mAb (NBP3-15427) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/Sodium-Potassium-ATPase-Alpha-1-Antibody-3L6F0-Immunocytochemistry-Immunofluorescence-NBP3-15427-img0005.jpg "Immunocytochemistry/Immunofluorescence: Sodium Potassium ATPase Alpha 1 Antibody (3L6F0) [NBP3-15427] - Immunofluorescence analysis of NIH-3T3 cells using Sodium Potassium ATPase Alpha 1 Rabbit mAb (NBP3-15427) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IHC |
| Clone | 3L6F0 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Sodium Potassium ATPase Alpha 1 (P05023). MGKGVGRDKYEPAAVSEQGDKKGKKGKKDRDMDELKKEVSMDDHKLSLDELHRKYGTDLSRGLTSARAAEILARDGPNALTPPPTTPEWIKFCRQLFGGF |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | ATP1A1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 113 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Sodium Potassium ATPase Alpha 1 Antibody (NBP3-15427)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ATP1A1 |
![Immunocytochemistry/Immunofluorescence: Sodium Potassium ATPase Alpha 1 Antibody (3L6F0) [NBP3-15427] - Immunofluorescence analysis of C6 cells using Sodium Potassium ATPase Alpha 1 Rabbit mAb (NBP3-15427) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/Sodium-Potassium-ATPase-Alpha-1-Antibody-3L6F0-Immunocytochemistry-Immunofluorescence-NBP3-15427-img0004.jpg "Immunocytochemistry/Immunofluorescence: Sodium Potassium ATPase Alpha 1 Antibody (3L6F0) [NBP3-15427] - Immunofluorescence analysis of C6 cells using Sodium Potassium ATPase Alpha 1 Rabbit mAb (NBP3-15427) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Western Blot: Sodium Potassium ATPase Alpha 1 Antibody (3L6F0) [NBP3-15427] - Analysis of extracts from HeLa cells, using Na+/K+-ATPase Rabbit mAb at 1:50000 dilution.Membrane protein extract isolated from Hela cells. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.](http://images.novusbio.com/fullsize/nbp3-15427_rabbit-sodium-potassium-atpase-alpha-1-mab-3l6f0-western-blot-20620239331..jpg "Western Blot: Sodium Potassium ATPase Alpha 1 Antibody (3L6F0) [NBP3-15427] - Analysis of extracts from HeLa cells, using Na+/K+-ATPase Rabbit mAb at 1:50000 dilution.Membrane protein extract isolated from Hela cells. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.")
![Western Blot: Sodium Potassium ATPase Alpha 1 Antibody (3L6F0) [NBP3-15427] - Analysis of various lysates, using Na+/K+-ATPase Rabbit mAb at 1:50000 dilution. Membrane protein extract isolated from Hela cells. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 30s.](http://images.novusbio.com/fullsize/nbp3-15427_rabbit-sodium-potassium-atpase-alpha-1-mab-3l6f0-western-blot-206202393441..jpg "Western Blot: Sodium Potassium ATPase Alpha 1 Antibody (3L6F0) [NBP3-15427] - Analysis of various lysates, using Na+/K+-ATPase Rabbit mAb at 1:50000 dilution. Membrane protein extract isolated from Hela cells. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 30s.")
![Immunohistochemistry-Paraffin: Sodium Potassium ATPase Alpha 1 Antibody (3L6F0) [NBP3-15427] - Analysis of Na+/K+-ATPase in paraffin-embedded human colon using Na+/K+-ATPase Rabbit mAb at dilution of 1:400 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/nbp3-15427_rabbit-sodium-potassium-atpase-alpha-1-mab-3l6f0-immunohistochemistry-paraffin-305202471030..jpg "Immunohistochemistry-Paraffin: Sodium Potassium ATPase Alpha 1 Antibody (3L6F0) [NBP3-15427] - Analysis of Na+/K+-ATPase in paraffin-embedded human colon using Na+/K+-ATPase Rabbit mAb at dilution of 1:400 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.")
![Immunohistochemistry-Paraffin: Sodium Potassium ATPase Alpha 1 Antibody (3L6F0) [NBP3-15427] - Analysis of Na+/K+-ATPase in paraffin-embedded human kidney using Na+/K+-ATPase Rabbit mAb at dilution of 1:400 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/nbp3-15427_rabbit-sodium-potassium-atpase-alpha-1-mab-3l6f0-immunohistochemistry-paraffin-305202471139..jpg "Immunohistochemistry-Paraffin: Sodium Potassium ATPase Alpha 1 Antibody (3L6F0) [NBP3-15427] - Analysis of Na+/K+-ATPase in paraffin-embedded human kidney using Na+/K+-ATPase Rabbit mAb at dilution of 1:400 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.")
![Immunohistochemistry-Paraffin: Sodium Potassium ATPase Alpha 1 Antibody (3L6F0) [NBP3-15427] - Analysis of Na+/K+-ATPase in paraffin-embedded human thyroid cancer using Na+/K+-ATPase Rabbit mAb at dilution of 1:400 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/nbp3-15427_rabbit-sodium-potassium-atpase-alpha-1-mab-3l6f0-immunohistochemistry-paraffin-305202471254..jpg "Immunohistochemistry-Paraffin: Sodium Potassium ATPase Alpha 1 Antibody (3L6F0) [NBP3-15427] - Analysis of Na+/K+-ATPase in paraffin-embedded human thyroid cancer using Na+/K+-ATPase Rabbit mAb at dilution of 1:400 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.")
![Immunohistochemistry: Sodium Potassium ATPase Alpha 1 Antibody (3L6F0) [Sodium Potassium ATPase Alpha 1] - Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using Sodium Potassium ATPase Alpha 1 Rabbit mAb at dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-15427_rabbit-sodium-potassium-atpase-alpha-1-mab-3l6f0-52202517172823.jpg "Immunohistochemistry: Sodium Potassium ATPase Alpha 1 Antibody (3L6F0) [Sodium Potassium ATPase Alpha 1] - Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using Sodium Potassium ATPase Alpha 1 Rabbit mAb at dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.")
![Immunocytochemistry/ Immunofluorescence: Sodium Potassium ATPase Alpha 1 Antibody (3L6F0) [Sodium Potassium ATPase Alpha 1] - Confocal imaging of human colon using Sodium Potassium ATPase Alpha 1 Rabbit mAb . DAPI was used for nuclear staining (blue). Objective: 40x. Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IF staining protocol.](http://images.novusbio.com/fullsize/nbp3-15427_rabbit-sodium-potassium-atpase-alpha-1-mab-3l6f0-52202517162347.jpg "Immunocytochemistry/ Immunofluorescence: Sodium Potassium ATPase Alpha 1 Antibody (3L6F0) [Sodium Potassium ATPase Alpha 1] - Confocal imaging of human colon using Sodium Potassium ATPase Alpha 1 Rabbit mAb . DAPI was used for nuclear staining (blue). Objective: 40x. Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IF staining protocol.")
![Immunohistochemistry: Sodium Potassium ATPase Alpha 1 Antibody (3L6F0) [Sodium Potassium ATPase Alpha 1] - Immunohistochemistry analysis of paraffin-embedded Mouse colon tissue using Sodium Potassium ATPase Alpha 1 Rabbit mAb at dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-15427_rabbit-sodium-potassium-atpase-alpha-1-mab-3l6f0-52202517251984.jpg "Immunohistochemistry: Sodium Potassium ATPase Alpha 1 Antibody (3L6F0) [Sodium Potassium ATPase Alpha 1] - Immunohistochemistry analysis of paraffin-embedded Mouse colon tissue using Sodium Potassium ATPase Alpha 1 Rabbit mAb at dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: Sodium Potassium ATPase Alpha 1 Antibody (3L6F0) [Sodium Potassium ATPase Alpha 1] - Immunohistochemistry analysis of paraffin-embedded Human liver tissue using Sodium Potassium ATPase Alpha 1 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-15427_rabbit-sodium-potassium-atpase-alpha-1-mab-3l6f0-52202517192982.jpg "Immunohistochemistry: Sodium Potassium ATPase Alpha 1 Antibody (3L6F0) [Sodium Potassium ATPase Alpha 1] - Immunohistochemistry analysis of paraffin-embedded Human liver tissue using Sodium Potassium ATPase Alpha 1 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.")
![Western Blot RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Western_Blot_10216.jpg)
![Immunocytochemistry RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Immunocytochemistry_10464.jpg)
![Simple Western RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Simple_Western_16629.jpg)
![Simple Western Coagulation Factor II/Thrombin Antibody [Unconjugated]](https://images.novusbio.com/images2/Coagulation_Factor_II_AF1148_Simple_Western_17119.jpg)
![Flow Cytometry Coagulation Factor II/Thrombin Antibody [Unconjugated]](https://images.novusbio.com/images2/Coagulation_Factor_II_AF1148_Flow_Cytometry_14472.jpg)
![Western Blot Coagulation Factor II/Thrombin Antibody [Unconjugated]](https://images.novusbio.com/images2/af1148_human-factor-ii-thrombin-affinity-purified-polyclonal-ab-western-blot-1862021152049.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")