![Western Blot: ATPase Na+/K+ beta 3 Antibody [H00000483-B01P] - Analysis of ATP1B3 expression in A-431.](http://images.novusbio.com/fullsize/ATPase-Na+-K+-beta-3-Antibody-Western-Blot-H00000483-B01P-img0005.jpg "Western Blot: ATPase Na+/K+ beta 3 Antibody [H00000483-B01P] - Analysis of ATP1B3 expression in A-431.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, Flow, ICC/IF |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody reactive against mammalian transfected lysate. |
| Immunogen | ATP1B3 (NP_001670.1, 1 a.a. - 279 a.a.) full-length human protein. MTKNEKKSLNQSLAEWKLFIYNPTTGEFLGRTAKSWGLILLFYLVFYGFLAALFSFTMWVMLQTLNDEVPKYRDQIPSPGLMVFPKPVTALEYTFSRSDPTSYAGYIEDLKKFLKPYTLEEQKNLTVCPDGALFEQKGPVYVACQFPISLLQACSGMNDPDFGYSQGNPCILVKMNRIIGLKPEGVPRIDCVSKNEDIPNVAVYPHNGMIDLKYFPYYGKKLHVGYLQPLVAVQVSFAPNNTGKEVTVECKIDGSANLKSQDDRDKFLGRVMFKITARA |
| Specificity | ATP1B3 - ATPase, Na+/K+ transporting, beta 3 polypeptide, |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | ATP1B3 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | GST tag alone is used as a negative control. Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID: 31009649). |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for ATPase Na+/K+ beta 3 Antibody (H00000483-B01P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ATP1B3 |
| Entrez |
|
| Uniprot |
|
![Flow Cytometry: ATPase Na+/K+ beta 3 Antibody [H00000483-B01P] - Analysis of negative control 293 cells (Black) and ATP1B3 expressing 293 cells (Green) using ATP1B3 purified mouse polyclonal antibody.](http://images.novusbio.com/fullsize/ATPase-Na+-K+-beta-3-Antibody-Flow-Cytometry-H00000483-B01P-img0004.jpg "Flow Cytometry: ATPase Na+/K+ beta 3 Antibody [H00000483-B01P] - Analysis of negative control 293 cells (Black) and ATP1B3 expressing 293 cells (Green) using ATP1B3 purified mouse polyclonal antibody.")
![Western Blot: ATPase Na+/K+ beta 3 Antibody [H00000483-B01P] - Analysis of ATP1B3 expression in transfected 293T cell line by ATP1B3 polyclonal antibody. Lane 1: ATP1B3 transfected lysate(30.69 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/ATPase-Na+-K+-beta-3-Antibody-Western-Blot-H00000483-B01P-img0006.jpg "Western Blot: ATPase Na+/K+ beta 3 Antibody [H00000483-B01P] - Analysis of ATP1B3 expression in transfected 293T cell line by ATP1B3 polyclonal antibody. Lane 1: ATP1B3 transfected lysate(30.69 KDa). Lane 2: Non-transfected lysate.")
![Chromatin Immunoprecipitation (ChIP) Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct-3_4_AF1759_Chromatin_Immunoprecipitation_11218.jpg)
![Immunocytochemistry Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct-3_4_AF1759_Immunocytochemistry_7093.jpg)
![Simple Western Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct3_4_AF1759_Simple_Western_20183.jpg)
![N/A Angiogenin [HRP]](https://images.novusbio.com/images2/Angiogenin_DAN00_ELISA_28.jpg)
![N/A Angiogenin [HRP]](https://images.novusbio.com/images2/DATA_Angiogenin_DAN00_ELISA_571.jpg)
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")