![Western Blot: SLC26A3 Antibody [NBP1-84450] - Analysis in control (vector only transfected HEK293T lysate) and SLC26A3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/SLC26A3-Antibody-Western-Blot-NBP1-84450-img0006.jpg "Western Blot: SLC26A3 Antibody [NBP1-84450] - Analysis in control (vector only transfected HEK293T lysate) and SLC26A3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, IHC, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DQPINTTDLPFHIDWNDDLPLNIEVPKISLHSLILDFSAVSFLDVSSVRGLKSILQEFIRIKVDVYIVGTDDDFIEKLNRYEFFDGEVKSSIFFLTIHDAVLHILMKKDYSTSKFNP |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SLC26A3 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
![Flow Cytometry ERMAP Antibody [Unconjugated]](https://images.novusbio.com/images2/ERMAP_AF4928_Flow_Cytometry_11957.jpg)
| Publication using NBP1-84450 | Applications | Species |
|---|---|---|
| Wang Y, Chiang IL, Ohara TE et al. Long-Term Culture Captures Injury-Repair Cycles of Colonic Stem Cells Cell 2019-11-14 [PMID: 31708126] (IHC-WhMt, Mouse) | IHC-WhMt | Mouse |
Secondary Antibodies |
Isotype Controls |
Research Areas for SLC26A3 Antibody (NBP1-84450)Find related products by research area.
|
|
Next-Gen DNA Sequencing and SLC26A3 Research The SLC26A3, also known as DRA (downregulated-in-adenoma) gene is a member of the sulphate anion transporter family, serving an important role in the exchange and transport of chloride, bicarbonate and sulphate ions at plasma membrane sites. We at Nov... Read full blog post. |
|
Antibody Therapies and the New Generation of DNA Sequencing Our antibody database is primarily focused on protein-coding genes. Although they form only 1% of the total human genome, these important genes account for 85% of the mutations that lead to disease.DNA sequencing (defining the sequence of the 4 base... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SLC26A3 |
![Immunohistochemistry-Paraffin: SLC26A3 Antibody [NBP1-84450] - Analysis in human colon and skeletal muscle tissues using NBP1-84450 antibody. Corresponding SLC26A3 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/SLC26A3-Antibody-Immunohistochemistry-Paraffin-NBP1-84450-img0007.jpg "Immunohistochemistry-Paraffin: SLC26A3 Antibody [NBP1-84450] - Analysis in human colon and skeletal muscle tissues using NBP1-84450 antibody. Corresponding SLC26A3 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: SLC26A3 Antibody [NBP1-84450] - Staining of human colon shows moderate positivity in glandular cells of apical membrane.](http://images.novusbio.com/fullsize/SLC26A3-Antibody-Immunohistochemistry-Paraffin-NBP1-84450-img0003.jpg "Immunohistochemistry-Paraffin: SLC26A3 Antibody [NBP1-84450] - Staining of human colon shows moderate positivity in glandular cells of apical membrane.")
![Immunohistochemistry-Paraffin: SLC26A3 Antibody [NBP1-84450] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/SLC26A3-Antibody-Immunohistochemistry-Paraffin-NBP1-84450-img0004.jpg "Immunohistochemistry-Paraffin: SLC26A3 Antibody [NBP1-84450] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Immunohistochemistry-Paraffin: SLC26A3 Antibody [NBP1-84450] - Staining of human small intestine shows moderate to strong positivity in apical membrane in glandular cells.](http://images.novusbio.com/fullsize/SLC26A3-Antibody-Immunohistochemistry-Paraffin-NBP1-84450-img0005.jpg "Immunohistochemistry-Paraffin: SLC26A3 Antibody [NBP1-84450] - Staining of human small intestine shows moderate to strong positivity in apical membrane in glandular cells.")
![Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CFTR_MAB25031_Immunohistochemistry_6973.jpg)
![Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CFTR_MAB25031_Immunohistochemistry_9671.jpg)
![Immunoprecipitation CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images/mab25031_human-cftr-c-terminus-mab-clone-24-1-41202412513815.jpg)
![Bioactivity IFN-gamma [Unconjugated]](https://images.novusbio.com/images2/IFNgamma_285IF_2848.jpg)
![SDS-PAGE IFN-gamma [Unconjugated]](https://images.novusbio.com/images2/IFN-gamma_285-IF_230.jpg)
![SEC-MALS IFN-gamma [Unconjugated]](https://images.novusbio.com/images/285-if_recombinant-human-ifn-gamma-protein-sec-mals-1520239228..jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Immunohistochemistry Lipoprotein Lipase/LPL Antibody [Unconjugated]](https://images.novusbio.com/images2/Lipoprotein_Lipase_AF7197_Immunohistochemistry_21186.jpg)
![Western Blot Lipoprotein Lipase/LPL Antibody [Unconjugated]](https://images.novusbio.com/images2/Lipoprotein_Lipase_AF7197_Western_Blot_11656.jpg)
![Immunocytochemistry Lipoprotein Lipase/LPL Antibody [Unconjugated]](https://images.novusbio.com/images2/Lipoprotein_Lipase_AF7197_Immunocytochemistry_11911.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")