![Western Blot: PTPN6 Antibody [NBP1-83276] - Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 18. Lane 2: Human cell line RT-4](http://images.novusbio.com/fullsize/PTPN6-Antibody-Western-Blot-NBP1-83276-img0006.jpg "Western Blot: PTPN6 Antibody [NBP1-83276] - Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 18. Lane 2: Human cell line RT-4")
| Reactivity | Hu, Rt, MuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: HAGPIIVHCSAGIGRTGTIIVIDMLMENISTKGLDCDIDIQKTIQMVRAQRSGMVQTEAQYKFIYVAIAQFIETTKKKLEVLQSQKGQESEYGNITYPPAMKNAHAKASRTSSKHKEDVYENLHTKNKREEKVKKQRSADKEKSKGSLK |
| Predicted Species | Mouse (92%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PTPN6 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot SHIP Antibody (257812) [Unconjugated]](https://images.novusbio.com/images2/SHIP_MAB2317_Western_Blot_6027.jpg)
![Immunocytochemistry SHIP Antibody (257812) [Unconjugated]](https://images.novusbio.com/images2/SHIP_MAB2317_Immunocytochemistry_9852.jpg)
![Knockout Validated SHIP Antibody (257812) [Unconjugated]](https://images.novusbio.com/images/mab2317_human-mouse-rat-ship-mab-clone-257812-20820241518568.jpg)
| Publication using NBP1-83276 | Applications | Species |
|---|---|---|
| McKenzie RC, Jones CL, Tosi I et al. Constitutive activation of STAT3 in Sezary syndrome is independent of SHP-1. Leukemia 2012-02-01 [PMID: 21818116] |
Secondary Antibodies |
Isotype Controls |
Research Areas for SHP-1 Antibody (NBP1-83276)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PTPN6 |
![Immunocytochemistry/Immunofluorescence: PTPN6 Antibody [NBP1-83276] - Staining of human cell line A-431 shows localization to nucleus. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/PTPN6-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83276-img0013.jpg "Immunocytochemistry/Immunofluorescence: PTPN6 Antibody [NBP1-83276] - Staining of human cell line A-431 shows localization to nucleus. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: PTPN6 Antibody [NBP1-83276] - Staining of human tonsil shows high expression.](http://images.novusbio.com/fullsize/PTPN6-Antibody-Immunohistochemistry-Paraffin-NBP1-83276-img0012.jpg "Immunohistochemistry-Paraffin: PTPN6 Antibody [NBP1-83276] - Staining of human tonsil shows high expression.")
![Western Blot: PTPN6 Antibody [NBP1-83276] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://images.novusbio.com/fullsize/PTPN6-Antibody-Western-Blot-NBP1-83276-img0004.jpg "Western Blot: PTPN6 Antibody [NBP1-83276] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).")
![Immunohistochemistry-Paraffin: PTPN6 Antibody [NBP1-83276] - Analysis in human tonsil and skeletal muscle tissues using Anti-PTPN6 antibody. Corresponding PTPN6 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/PTPN6-Antibody-Immunohistochemistry-Paraffin-NBP1-83276-img0010.jpg "Immunohistochemistry-Paraffin: PTPN6 Antibody [NBP1-83276] - Analysis in human tonsil and skeletal muscle tissues using Anti-PTPN6 antibody. Corresponding PTPN6 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: PTPN6 Antibody [NBP1-83276] - Staining of human skeletal muscle shows low expression as expected.](http://images.novusbio.com/fullsize/PTPN6-Antibody-Immunohistochemistry-Paraffin-NBP1-83276-img0011.jpg "Immunohistochemistry-Paraffin: PTPN6 Antibody [NBP1-83276] - Staining of human skeletal muscle shows low expression as expected.")
![Western Blot SHP-2/PTPN11 [p Tyr542] Antibody [Unconjugated]](https://images.novusbio.com/images2/SHP-2_AF3790_Western_Blot_5344.jpg)
![Simple Western SHP-2/PTPN11 [p Tyr542] Antibody [Unconjugated]](https://images.novusbio.com/images2/16330.jpg)
![Immunocytochemistry SHP-2/PTPN11 [p Tyr542] Antibody [Unconjugated]](https://images.novusbio.com/images2/af3790_human-mouse-phospho-shp-2-y542-affinity-purified-pab-immunocytochemistry-243202212955.jpg)
![Western Blot Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/Src_AF2685_Western_Blot_5209.jpg)
![Simple Western Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/16327.jpg)
![Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/Src_AF2685_Immunohistochemistry_7158.jpg)
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![Immunocytochemistry/ Immunofluorescence Jak2 [p Tyr1007, p Tyr1008] Antibody (SY24-03)](https://images.novusbio.com/images/Jak2-p-Tyr1007-p-Tyr1008-Antibody-SY24-03-Immunocytochemistry-Immunofluorescence-NBP2-67429-img0001.jpg)
![Immunohistochemistry-Paraffin Jak2 [p Tyr1007, p Tyr1008] Antibody (SY24-03)](https://images.novusbio.com/images/Jak2-p-Tyr1007-p-Tyr1008-Antibody-SY24-03-Immunohistochemistry-Paraffin-NBP2-67429-img0002.jpg)
![Immunohistochemistry-Paraffin Jak2 [p Tyr1007, p Tyr1008] Antibody (SY24-03)](https://images.novusbio.com/images/Jak2-p-Tyr1007-p-Tyr1008-Antibody-SY24-03-Immunohistochemistry-Paraffin-NBP2-67429-img0003.jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Intracellular Staining by Flow Cytometry Reg1A Antibody (431202) [Unconjugated]](https://images.novusbio.com/images2/Reg1A_MAB4937_Flow_Cytometry_8512.jpg)
![Knockout Validated STAT3 Antibody (232209) [Unconjugated]](https://images.novusbio.com/images2/STAT3_MAB1799_Simple_Western_21000.jpg)
![Western Blot STAT3 Antibody (232209) [Unconjugated]](https://images.novusbio.com/images2/STAT3_MAB1799_Western_Blot_5993.jpg)
![Knockout Validated STAT3 Antibody (232209) [Unconjugated]](https://images.novusbio.com/images2/STAT3_MAB1799_Knockout_Validated_21531.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot GRB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/GRB2_AF3846_Western_Blot_5355.jpg)
![Immunohistochemistry GRB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/GRB2_AF3846_Immunohistochemistry_6809.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")