Home » SGLT1/SLC5A1 » SGLT1/SLC5A1 Proteins » SGLT1/SLC5A1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

SGLT1/SLC5A1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for SGLT1/SLC5A1 Protein (NBP2-33629PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

SGLT1/SLC5A1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SLC5A1.

Source: E. coli

Amino Acid Sequence: DLDAEEENIQEGPKETIEIETQVPEKKKGIFRRAYDLFCGLEQHGAPKMTEEEEKAMKMKMTDTSEKPLWR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SLC5A1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33629.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SGLT1/SLC5A1 Recombinant Protein Antigen

  • D22S675
  • High affinity sodium-glucose cotransporter
  • Na+/glucose cotransporter 1
  • NAGT
  • NAGTsodium/glucose cotransporter 1
  • SGLT1
  • SGLT1Na(+)/glucose cotransporter 1
  • SLC5A1
  • solute carrier family 5 (sodium/glucose cotransporter), member 1
  • Solute carrier family 5 member 1

Background

Glucose transporters are integral membrane proteins that mediate the transport of glucose and structurally related substances across cellular membranes. Two families of glucose transporter have been identified: the facilitated diffusion glucose transporter family (GLUT family), also known as 'uniporters,' and the sodium dependent glucose transporter family (SGLT family), also known as 'cotransporters' or 'symporters'. The SGLT1 gene encodes a protein that is involved in the active transport of glucose and galactose into eukaryotic and some prokaryotic cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Glut2 Antibody -
BSA Free
NBP2-22218
Western Blot Glut2 Antibody - BSA Free
Immunohistochemistry-Paraffin Glut2 Antibody - BSA Free
Immunohistochemistry-Paraffin Glut2 Antibody - BSA Free
(2 Reviews)
(15 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
SGLT2/SLC5A2
Antibody
NBP1-92384
Immunohistochemistry-Paraffin SGLT2/SLC5A2 Antibody
Immunohistochemistry-Paraffin SGLT2/SLC5A2 Antibody
Immunohistochemistry-Paraffin SGLT2/SLC5A2 Antibody
(2 Reviews)
(12 Publications)
Species: Ca, Hu, Mu, Tn
Applications: ICC/IF, IHC, IHC-P, WB
Glut1 Antibody -
BSA Free
NB110-39113
Western Blot Glut1 Antibody - BSA Free
Flow Cytometry Glut1 Antibody - BSA Free
Western Blot Glut1 Antibody - BSA Free
(7 Reviews)
(61 Publications)
Species: Hu, Mu, Rb, Rt
Applications: ChIP, ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, Simple Western, WB
Glut5 Antibody
(OTI9F3)
NBP1-47980
Flow Cytometry Glut5 Antibody (OTI9F3)
Flow Cytometry Glut5 Antibody (OTI9F3)
Western Blot Glut5 Antibody (OTI9F3)
(1 Review)
Species: Hu, Pm
Applications: Flow, IHC, IHC-P, IP, WB
PEPT1/SLC15A1
Antibody
NBP1-92005
Immunohistochemistry-Paraffin PEPT1/SLC15A1 Antibody
Immunocytochemistry/ Immunofluorescence PEPT1/SLC15A1 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Glut4 Antibody -
BSA Free
NBP1-49533
Flow (Intracellular) Glut4 Antibody - BSA Free
Western Blot Glut4 Antibody - BSA Free
Western Blot Glut4 Antibody - BSA Free
(4 Reviews)
(41 Publications)
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
Lactase Antibody
NBP3-12238
Immunohistochemistry-Paraffin Lactase Antibody
Immunohistochemistry-Paraffin Lactase Antibody
Immunohistochemistry-Paraffin Lactase Antibody
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB

beta-Galactosidase-1/G ...
NBP2-45731
Western Blot beta-Galactosidase-1/GLB1 Antibody (OTI1C9)
Immunohistochemistry beta-Galactosidase-1/GLB1 Antibody (OTI1C9)
Immunohistochemistry beta-Galactosidase-1/GLB1 Antibody (OTI1C9)
(6 Publications)
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
NHE3/SLC9A3
Antibody
NBP1-82574
Immunohistochemistry-Paraffin NHE3/SLC9A3 Antibody
Immunohistochemistry-Paraffin NHE3/SLC9A3 Antibody
Immunohistochemistry-Paraffin NHE3/SLC9A3 Antibody
(30 Publications)
Species: Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, PAGE, WB
RSC1A1 Antibody
NBP1-80811
Immunohistochemistry-Paraffin RSC1A1 Antibody
Immunocytochemistry/ Immunofluorescence RSC1A1 Antibody
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
GIP Antibody
(911205) [Unconjugate
MAB8864
Immunohistochemistry GIP Antibody (911205) [Unconjugated]
(1 Publication)
Species: Hu
Applications: IHC
Glut3 Antibody
(202017) [Unconjugate
MAB1415
Flow Cytometry Glut3 Antibody (202017) [Unconjugated]
Immunocytochemistry Glut3 Antibody (202017) [Unconjugated]
(7 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, ICC
PRRT2 Antibody -
BSA Free
NBP2-82026
Western Blot PRRT2 Antibody - BSA Free
Immunohistochemistry PRRT2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence PRRT2 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
SGK1 Antibody
(4D7-G3)
H00006446-M01
Western Blot SGK1 Antibody (4D7-G3)
Immunocytochemistry/ Immunofluorescence SGK1 Antibody (4D7-G3)
Immunohistochemistry-Paraffin SGK1 Antibody (4D7-G3)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
AMELX Antibody
NBP2-15373
Western Blot AMELX Antibody
Western Blot AMELX Antibody
Species: Hu, Mu
Applications: WB
SLC5A11 Antibody
NBP1-82862
Immunocytochemistry/ Immunofluorescence SLC5A11 Antibody
Immunohistochemistry-Paraffin SLC5A11 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
EAAT3 Antibody
(S180-41)
NBP2-59319
Western Blot EAAT3 Antibody (S180-41)
Immunocytochemistry/ Immunofluorescence EAAT3 Antibody (S180-41)
Immunocytochemistry/ Immunofluorescence EAAT3 Antibody (S180-41)
Species: Hu, Rt
Applications: ICC/IF, IP, WB
Aminopeptidase
N/CD13 Antibody [Unco ...
AF2335
Immunocytochemistry Aminopeptidase N/CD13 Antibody [Unconjugated]
Immunohistochemistry Aminopeptidase N/CD13 Antibody [Unconjugated]
(53 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, IP, WB
SGLT1/SLC5A1
Recombinant Protein A ...
NBP2-33629PEP
SGLT1/SLC5A1 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for SGLT1/SLC5A1 Protein (NBP2-33629PEP) (0)

There are no publications for SGLT1/SLC5A1 Protein (NBP2-33629PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SGLT1/SLC5A1 Protein (NBP2-33629PEP) (0)

There are no reviews for SGLT1/SLC5A1 Protein (NBP2-33629PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SGLT1/SLC5A1 Protein (NBP2-33629PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SGLT1/SLC5A1 Products

Research Areas for SGLT1/SLC5A1 Protein (NBP2-33629PEP)

Find related products by research area.

Blogs on SGLT1/SLC5A1

There are no specific blogs for SGLT1/SLC5A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Western Blot: Glut1 Antibody [NB110-39113] - Glut1 in human brain lysate (55 kDa). Antibody at 1:500. Western blot image submitted by a verified customer review.
Glut1 Antibody - BSA Free
NB110-39113
Flow (Intracellular): Glut4 Antibody [NBP1-49533] - An intracellular stain was performed on HepG2 with NBP1-49533 and a matched isotype control. Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature, followed by Rabbit IgG (H+L) Cross-Adsorbed Secondary Antibody.
Glut4 Antibody - BSA Free
NBP1-49533

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SGLT1/SLC5A1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol SLC5A1