![Western Blot: SETMAR Antibody [H00006419-B01P] - Analysis of SETMAR expression in human kidney.](http://images.novusbio.com/fullsize/SETMAR-Antibody-Western-Blot-H00006419-B01P-img0002.jpg "Western Blot: SETMAR Antibody [H00006419-B01P] - Analysis of SETMAR expression in human kidney.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody reactive against mammalian transfected lysate. |
| Immunogen | SETMAR (AAH11635.1, 1 a.a. - 352 a.a.) full-length human protein. MAEFKEKPEAPTEQLDVACGQENLPVGAWPPGAAPAPFQYTPDHVVGPGADIDPTQITFPGCICVKTPCLPGTCSCLRHGENYDDNSCLRDIGSGGKYAEPVFECNVLCRCSDHCRNRVVQKGLQFHFQVFKTHKKGWGLRTLEFIPKGRFVCEYAGEVLGFSEVQRRIHLQTKSDSNYIIAIREHVYNGQVMETFVDPTYIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAAKDIVPEEELSYDYSGRYLNLTVSEDKERLDHGKLRKPCYCGAKSCTAFLPFDSSLYCPVEKSNISCGNEKEPSMCGSAPSVFPSCKRLTLEVSLFSDKQLAPPYSGRQWLASFTSA |
| Specificity | SETMAR - SET domain and mariner transposase fusion gene, |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | SETMAR |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SETMAR |
| Entrez |
|
| Uniprot |
|
![Western Blot: SETMAR Antibody [H00006419-B01P] - Analysis of SETMAR expression in transfected 293T cell line by SETMAR polyclonal antibody. Lane 1: SETMAR transfected lysate(38.72 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/SETMAR-Antibody-Western-Blot-H00006419-B01P-img0003.jpg "Western Blot: SETMAR Antibody [H00006419-B01P] - Analysis of SETMAR expression in transfected 293T cell line by SETMAR polyclonal antibody. Lane 1: SETMAR transfected lysate(38.72 KDa). Lane 2: Non-transfected lysate.")
![Western Blot Histone H2AX [p Ser139] Antibody [Unconjugated]](https://images.novusbio.com/images2/Histone_H2AX_AF2288_Western_Blot_5182.jpg)
![Simple Western Histone H2AX [p Ser139] Antibody [Unconjugated]](https://images.novusbio.com/images2/16395.jpg)
![Immunocytochemistry Histone H2AX [p Ser139] Antibody [Unconjugated]](https://images.novusbio.com/images2/Histone_H2AX_AF2288_Immunocytochemistry__Immunofluorescence_16920.jpg)
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")