![Immunohistochemistry-Paraffin: Serpin I1/Neuroserpin Antibody [NBP2-38784] - Staining of human duodenum shows low expression as expected.](http://images.novusbio.com/fullsize/Serpin-I1-Neuroserpin-Antibody-Immunohistochemistry-Paraffin-NBP2-38784-img0002.jpg "Immunohistochemistry-Paraffin: Serpin I1/Neuroserpin Antibody [NBP2-38784] - Staining of human duodenum shows low expression as expected.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: TGEDENILFSPLSIALAMGMMELGAQGSTQKEIRHSMGYDSLKNGEEFSFLKEFSNMVTAKESQYVMKIANSLFVQNGFHVNEEFLQMMKKYFNAAVNHVDFSQNVAVANYINKWVENNTNNLVKDLVSPRDFDAATYLALINAVYFKGN |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SERPINI1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Knockout Validated SerpinB2 Antibody (930109) [Unconjugated]](https://images.novusbio.com/images2/Serpin_B2_MAB8550_Knockout_Validated_21056.jpg)
![Immunocytochemistry SerpinB2 Antibody (930109) [Unconjugated]](https://images.novusbio.com/images2/Serpin_B2_MAB8550_Immunocytochemistry__Immunofluorescence_17162.jpg)
![Western Blot SerpinB2 Antibody (930109) [Unconjugated]](https://images.novusbio.com/images2/Serpin_B2_MAB8550_Western_Blot_17242.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Serpin I1/Neuroserpin Antibody (NBP2-38784)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry: Serpin I1/Neuroserpin Antibody [NBP2-38784] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.](http://images.novusbio.com/fullsize/Serpin-I1-Neuroserpin-Antibody-Immunohistochemistry-NBP2-38784-img0001.jpg "Immunohistochemistry: Serpin I1/Neuroserpin Antibody [NBP2-38784] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.")
![Immunohistochemistry-Paraffin: Serpin I1/Neuroserpin Antibody [NBP2-38784] - Staining in human cerebral cortex and duodenum tissues using anti-SERPINI1 antibody. Corresponding SERPINI1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Serpin-I1-Neuroserpin-Antibody-Immunohistochemistry-Paraffin-NBP2-38784-img0003.jpg "Immunohistochemistry-Paraffin: Serpin I1/Neuroserpin Antibody [NBP2-38784] - Staining in human cerebral cortex and duodenum tissues using anti-SERPINI1 antibody. Corresponding SERPINI1 RNA-seq data are presented for the same tissues.")
![N/A t-Plasminogen Activator/tPA [HRP]](https://images.novusbio.com/images2/DATA_tPlasminogen_Activator_DTPA00_ELISA_854.jpg)
![N/A t-Plasminogen Activator/tPA [HRP]](https://images.novusbio.com/images2/tPlasminogen_Activator_DTPA00_ELISA_510.jpg)
![Enzyme Activity u-Plasminogen Activator/Urokinase [Unconjugated]](https://images.novusbio.com/images2/uPlasminogen_Activator_1310SE_1837.jpg)
![Western Blot Serpin A1/alpha 1-Antitrypsin Antibody (202808) [Unconjugated]](https://images.novusbio.com/images2/Serpin_A1_MAB1268_Western_Blot_17309.jpg)
![Simple Western Serpin A1/alpha 1-Antitrypsin Antibody (202808) [Unconjugated]](https://images.novusbio.com/images2/Serpin_A1_MAB1268_Immunocytochemistry__Immunofluorescence_17494.jpg)
![Immunocytochemistry Serpin A1/alpha 1-Antitrypsin Antibody (202808) [Unconjugated]](https://images.novusbio.com/images2/Serpin_A1_MAB1268_Immunocytochemistry_11973.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")