![Western Blot: SEC61A Antibody [NBP2-86797] - Host: Rabbit. Target Name: SEC61A1. Sample Type: Human Fetal Lung. Antibody Dilution: 1.0ug/ml](http://images.novusbio.com/fullsize/SEC61A-Antibody-Western-Blot-NBP2-86797-img0003.jpg "Western Blot: SEC61A Antibody [NBP2-86797] - Host: Rabbit. Target Name: SEC61A1. Sample Type: Human Fetal Lung. Antibody Dilution: 1.0ug/ml")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 0.5 mg/ml |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human SEC61A. Peptide sequence: TWIEVSGSSAKDVAKQLKEQQMVMRGHRETSMVHELNRYIPTAAAFGGLC The peptide sequence for this immunogen was taken from within the described region. |
| Specificity | This antibody made against SEC61A1 but the immunogen shows 98% sequence identity with human SEC61A2. Reactivity with SEC61A2 has not been determined experimentally. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SEC61A1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for SEC61A Antibody (NBP2-86797)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SEC61A1 |
![Western Blot: SEC61A Antibody [NBP2-86797] - WB Suggested Anti-SEC61A1 Antibody. Titration: 1.0 ug/ml. Positive Control: HT1080 Whole CellSEC61A1 is supported by BioGPS gene expression data to be expressed in HT1080](http://images.novusbio.com/fullsize/SEC61A-Antibody-Western-Blot-NBP2-86797-img0001.jpg "Western Blot: SEC61A Antibody [NBP2-86797] - WB Suggested Anti-SEC61A1 Antibody. Titration: 1.0 ug/ml. Positive Control: HT1080 Whole CellSEC61A1 is supported by BioGPS gene expression data to be expressed in HT1080")
![Western Blot: SEC61A Antibody [NBP2-86797] - Host: Rabbit. Target Name: SEC61A1. Sample Type: Human Adult Placenta. Antibody Dilution: 1.0ug/ml](http://images.novusbio.com/fullsize/SEC61A-Antibody-Western-Blot-NBP2-86797-img0002.jpg "Western Blot: SEC61A Antibody [NBP2-86797] - Host: Rabbit. Target Name: SEC61A1. Sample Type: Human Adult Placenta. Antibody Dilution: 1.0ug/ml")
![Immunohistochemistry BMP-3b/GDF-10 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af1543_human-bmp-3b-gdf-10-affinity-purified-polyclonal-ab-immunocytochemistry-133202414504.jpg)
![Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CFTR_MAB25031_Immunohistochemistry_6973.jpg)
![Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CFTR_MAB25031_Immunohistochemistry_9671.jpg)
![Immunoprecipitation CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images/mab25031_human-cftr-c-terminus-mab-clone-24-1-41202412513815.jpg)
![N/A CD40 Ligand/TNFSF5 [HRP]](https://images.novusbio.com/images2/CD40_Ligand_DCDL40_ELISA_60.jpg)
![N/A CD40 Ligand/TNFSF5 [HRP]](https://images.novusbio.com/images2/DATA_CD40_Ligand_DCDL40_ELISA_624.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")