![Western Blot: SAT2 Antibody [NBP1-80722] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/fullsize/SAT2-Antibody-Western-Blot-NBP1-80722-img0005.jpg "Western Blot: SAT2 Antibody [NBP1-80722] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: IYVMPEYRGQGIGSKIIKKVAEVALDKGCSQFRLAVLDWNQRAMDLYKALGAQDLTEAEGWHFFCFQGEATRKLAGK |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SAT2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for SAT2 Antibody (NBP1-80722)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: SAT2 Antibody [NBP1-80722] - Staining of human colon.](http://images.novusbio.com/fullsize/SAT2-Antibody-Immunohistochemistry-Paraffin-NBP1-80722-img0011.jpg "Immunohistochemistry-Paraffin: SAT2 Antibody [NBP1-80722] - Staining of human colon.")
![Immunohistochemistry-Paraffin: SAT2 Antibody [NBP1-80722] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/fullsize/SAT2-Antibody-Immunohistochemistry-Paraffin-NBP1-80722-img0008.jpg "Immunohistochemistry-Paraffin: SAT2 Antibody [NBP1-80722] - Staining of human pancreas shows low expression as expected.")
![Immunohistochemistry-Paraffin: SAT2 Antibody [NBP1-80722] - Staining of human adrenal gland shows high expression.](http://images.novusbio.com/fullsize/SAT2-Antibody-Immunohistochemistry-Paraffin-NBP1-80722-img0007.jpg "Immunohistochemistry-Paraffin: SAT2 Antibody [NBP1-80722] - Staining of human adrenal gland shows high expression.")
![Immunohistochemistry-Paraffin: SAT2 Antibody [NBP1-80722] - Staining in human adrenal gland and pancreas tissues using anti-SAT2 antibody. Corresponding SAT2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/SAT2-Antibody-Immunohistochemistry-Paraffin-NBP1-80722-img0009.jpg "Immunohistochemistry-Paraffin: SAT2 Antibody [NBP1-80722] - Staining in human adrenal gland and pancreas tissues using anti-SAT2 antibody. Corresponding SAT2 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: SAT2 Antibody [NBP1-80722] - Staining of human adrenal gland, colon, pancreas and small intestine using Anti-SAT2 antibody NBP1-80722 (A) shows similar protein distribution across tissues to independent antibody NBP2-49244 (B).](http://images.novusbio.com/fullsize/SAT2-Antibody-Immunohistochemistry-Paraffin-NBP1-80722-img0010.jpg "Immunohistochemistry-Paraffin: SAT2 Antibody [NBP1-80722] - Staining of human adrenal gland, colon, pancreas and small intestine using Anti-SAT2 antibody NBP1-80722 (A) shows similar protein distribution across tissues to independent antibody NBP2-49244 (B).")
![Immunohistochemistry-Paraffin: SAT2 Antibody [NBP1-80722] - Staining of human small intestine.](http://images.novusbio.com/fullsize/SAT2-Antibody-Immunohistochemistry-Paraffin-NBP1-80722-img0012.jpg "Immunohistochemistry-Paraffin: SAT2 Antibody [NBP1-80722] - Staining of human small intestine.")
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Simple Western PAG1 Antibody (504004) [Unconjugated]](https://images.novusbio.com/images2/PAG1_MAB5285_Simple_Western_16616.jpg)
![Western Blot PAG1 Antibody (504004) [Unconjugated]](https://images.novusbio.com/images2/PAG1_MAB5285_Western_Blot_9455.jpg)
![Western Blot RACK1/GNB2L1 Antibody [Unconjugated]](https://images.novusbio.com/images2/RACK1_AF3434_Western_Blot_5298.jpg)
![Immunocytochemistry RACK1/GNB2L1 Antibody [Unconjugated]](https://images.novusbio.com/images2/RACK1_AF3434_Immunocytochemistry__Immunofluorescence_19362.jpg)
![Western Blot WNK1 Antibody [Unconjugated]](https://images.novusbio.com/images2/WNK1_AF2849_Western_Blot_5218.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")