![Western Blot: RPL19 Antibody [NBP3-16045] - Analysis of extracts of various cell lines, using RPL19 antibody (NBP3-16045) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.](http://images.novusbio.com/fullsize/RPL19-Antibody-Western-Blot-NBP3-16045-img0007.jpg "Western Blot: RPL19 Antibody [NBP3-16045] - Analysis of extracts of various cell lines, using RPL19 antibody (NBP3-16045) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RPL19 (NP_000972.1). MSMLRLQKRLASSVLRCGKKKVWLDPNETNEIANANSRQQIRKLIKDGLIIRKPVTVHSRARCRKNTLARRKGRHMGIGKRKGTANARMPEKVTWMRRMR |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RPL19 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS, 50% glycerol, pH7.3 |
| Preservative | 0.05% Proclin 300 |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RPL19 |
![Immunocytochemistry/Immunofluorescence: RPL19 Antibody [NBP3-16045] - Immunofluorescence analysis of U2OS cells using RPL19 Rabbit pAb (NBP3-16045) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/RPL19-Antibody-Immunocytochemistry-Immunofluorescence-NBP3-16045-img0006.jpg "Immunocytochemistry/Immunofluorescence: RPL19 Antibody [NBP3-16045] - Immunofluorescence analysis of U2OS cells using RPL19 Rabbit pAb (NBP3-16045) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.")
![Immunohistochemistry-Paraffin: RPL19 Antibody [NBP3-16045] - Human liver cancer using RPL19 Rabbit pAb (NBP3-16045) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/RPL19-Antibody-Immunohistochemistry-Paraffin-NBP3-16045-img0003.jpg "Immunohistochemistry-Paraffin: RPL19 Antibody [NBP3-16045] - Human liver cancer using RPL19 Rabbit pAb (NBP3-16045) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.")
![Immunocytochemistry/Immunofluorescence: RPL19 Antibody [NBP3-16045] - Immunofluorescence analysis of NIH/3T3 cells using RPL19 Rabbit pAb (NBP3-16045) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/RPL19-Antibody-Immunocytochemistry-Immunofluorescence-NBP3-16045-img0004.jpg "Immunocytochemistry/Immunofluorescence: RPL19 Antibody [NBP3-16045] - Immunofluorescence analysis of NIH/3T3 cells using RPL19 Rabbit pAb (NBP3-16045) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.")
![Immunocytochemistry/Immunofluorescence: RPL19 Antibody [NBP3-16045] - Immunofluorescence analysis of PC-12 cells using RPL19 Rabbit pAb (NBP3-16045) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/RPL19-Antibody-Immunocytochemistry-Immunofluorescence-NBP3-16045-img0005.jpg "Immunocytochemistry/Immunofluorescence: RPL19 Antibody [NBP3-16045] - Immunofluorescence analysis of PC-12 cells using RPL19 Rabbit pAb (NBP3-16045) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.")
![Immunohistochemistry-Paraffin: RPL19 Antibody [NBP3-16045] - Mouse kidney using RPL19 Rabbit pAb (NBP3-16045) at dilution of 1:250 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/RPL19-Antibody-Immunohistochemistry-Paraffin-NBP3-16045-img0001.jpg "Immunohistochemistry-Paraffin: RPL19 Antibody [NBP3-16045] - Mouse kidney using RPL19 Rabbit pAb (NBP3-16045) at dilution of 1:250 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.")
![Immunohistochemistry-Paraffin: RPL19 Antibody [NBP3-16045] - Human brain using RPL19 Rabbit pAb (NBP3-16045) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/RPL19-Antibody-Immunohistochemistry-Paraffin-NBP3-16045-img0002.jpg "Immunohistochemistry-Paraffin: RPL19 Antibody [NBP3-16045] - Human brain using RPL19 Rabbit pAb (NBP3-16045) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.")
![Immunocytochemistry TM4SF1/L6 Antibody (877621) [Unconjugated]](https://images.novusbio.com/images2/TM4SF1_MAB8164_Immunohistochemistry_19084.jpg)
![Flow Cytometry TM4SF1/L6 Antibody (877621) [Unconjugated]](https://images.novusbio.com/images2/TM4SF1_MAB8164_Flow_Cytometry_14781.jpg)
![Flow Cytometry TM4SF1/L6 Antibody (877621) [Unconjugated]](https://images.novusbio.com/images2/TM4SF1_MAB8164_Flow_Cytometry_14884.jpg)
![Bioactivity IL-2 [Unconjugated]](https://images.novusbio.com/images/202-il_recombinant-human-il-2-protein-bioactivity-174202314946.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")