![Western Blot: RPL24/RLP24 Antibody [NBP2-38992] - Analysis using Anti-RSL24D1 antibody NBP2-38992 (A) shows similar pattern to independent antibody NBP2-38971 (B).](http://images.novusbio.com/fullsize/RPL24-RLP24-Antibody-Western-Blot-NBP2-38992-img0006.jpg "Western Blot: RPL24/RLP24 Antibody [NBP2-38992] - Analysis using Anti-RSL24D1 antibody NBP2-38992 (A) shows similar pattern to independent antibody NBP2-38971 (B).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KCYFCSGPIYPGHGMMFVRNDCKVFRFCKSKCHKNFKKKRNPRKVRWTKAFRKAAGKELTVDNSFEFEKRRNEPIKYQ |
| Predicted Species | Mouse (99%), Rat (99%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RSL24D1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for RPL24/RLP24 Antibody (NBP2-38992)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: RPL24/RLP24 Antibody [NBP2-38992] - Immunofluorescent staining of human cell line SK-MEL-30 shows localization to nucleus & nucleoli. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/RPL24-RLP24-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38992-img0004.jpg "Immunocytochemistry/Immunofluorescence: RPL24/RLP24 Antibody [NBP2-38992] - Immunofluorescent staining of human cell line SK-MEL-30 shows localization to nucleus & nucleoli. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: RPL24/RLP24 Antibody [NBP2-38992] - Staining of human colon.](http://images.novusbio.com/fullsize/RPL24-RLP24-Antibody-Immunohistochemistry-Paraffin-NBP2-38992-img0009.jpg "Immunohistochemistry-Paraffin: RPL24/RLP24 Antibody [NBP2-38992] - Staining of human colon.")
![Immunohistochemistry-Paraffin: RPL24/RLP24 Antibody [NBP2-38992] - Staining of human cerebellum shows strong nucleolar positivity in Purkinje cells.](http://images.novusbio.com/fullsize/RPL24-RLP24-Antibody-Immunohistochemistry-Paraffin-NBP2-38992-img0002.jpg "Immunohistochemistry-Paraffin: RPL24/RLP24 Antibody [NBP2-38992] - Staining of human cerebellum shows strong nucleolar positivity in Purkinje cells.")
![Immunohistochemistry-Paraffin: RPL24/RLP24 Antibody [NBP2-38992] - Staining of human colon, kidney, liver and testis using Anti-RSL24D1 antibody NBP2-38992 (A) shows similar protein distribution across tissues to independent antibody NBP2-38971 (B).](http://images.novusbio.com/fullsize/RPL24-RLP24-Antibody-Immunohistochemistry-Paraffin-NBP2-38992-img0005.jpg "Immunohistochemistry-Paraffin: RPL24/RLP24 Antibody [NBP2-38992] - Staining of human colon, kidney, liver and testis using Anti-RSL24D1 antibody NBP2-38992 (A) shows similar protein distribution across tissues to independent antibody NBP2-38971 (B).")
![Immunohistochemistry-Paraffin: RPL24/RLP24 Antibody [NBP2-38992] - Staining of human kidney.](http://images.novusbio.com/fullsize/RPL24-RLP24-Antibody-Immunohistochemistry-Paraffin-NBP2-38992-img0007.jpg "Immunohistochemistry-Paraffin: RPL24/RLP24 Antibody [NBP2-38992] - Staining of human kidney.")
![Immunohistochemistry-Paraffin: RPL24/RLP24 Antibody [NBP2-38992] - Staining of human testis.](http://images.novusbio.com/fullsize/RPL24-RLP24-Antibody-Immunohistochemistry-Paraffin-NBP2-38992-img0008.jpg "Immunohistochemistry-Paraffin: RPL24/RLP24 Antibody [NBP2-38992] - Staining of human testis.")
![Immunohistochemistry-Paraffin: RPL24/RLP24 Antibody [NBP2-38992] - Staining of human liver.](http://images.novusbio.com/fullsize/RPL24-RLP24-Antibody-Immunohistochemistry-Paraffin-NBP2-38992-img0010.jpg "Immunohistochemistry-Paraffin: RPL24/RLP24 Antibody [NBP2-38992] - Staining of human liver.")
![Immunocytochemistry TM4SF1/L6 Antibody (877621) [Unconjugated]](https://images.novusbio.com/images2/TM4SF1_MAB8164_Immunohistochemistry_19084.jpg)
![Flow Cytometry TM4SF1/L6 Antibody (877621) [Unconjugated]](https://images.novusbio.com/images2/TM4SF1_MAB8164_Flow_Cytometry_14781.jpg)
![Flow Cytometry TM4SF1/L6 Antibody (877621) [Unconjugated]](https://images.novusbio.com/images2/TM4SF1_MAB8164_Flow_Cytometry_14884.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")