![Western Blot: RHOT2 Antibody [NBP1-88982] - Analysis in human cell line HEK 293.](http://images.novusbio.com/fullsize/RHOT2-Antibody-Western-Blot-NBP1-88982-img0009.jpg "Western Blot: RHOT2 Antibody [NBP1-88982] - Analysis in human cell line HEK 293.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, Simple Western, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RSCLGHLGYLGYPTLCEQDQAHAITVTREKRLDQEKGQTQRSVLLCKVVGACGVGKSAFLQAFLGRGLGHQDTREQPPGYAIDTVQVNGQEKYLILC |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RHOT2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | WB, ICC/IF reported in the literature (PMID:24671417). ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100. IHC-Paraffin HIER pH6 retrieval is recommended. Simple Western only 10 - 15 uL of the recommended dilution is used per data point. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-88982 | Applications | Species |
|---|---|---|
| Birsa N, Norkett R, Wauer T et al. Lysine 27 Ubiquitination of the Mitochondrial Transport Protein Miro Is Dependent on Serine 65 of the Parkin Ubiquitin Ligase. J Biol Chem 2014-05-23 [PMID: 24671417] (WB, ICC/IF, Human) | WB, ICC/IF | Human |
| Images | Ratings | Applications | Species | Date | Details | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
reviewed by:
Verified Customer |
WB | Human | 04/11/2019 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
Research Areas for RHOT2 Antibody (NBP1-88982)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RHOT2 |
![Immunocytochemistry/Immunofluorescence: RHOT2 Antibody [NBP1-88982] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/RHOT2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88982-img0011.jpg "Immunocytochemistry/Immunofluorescence: RHOT2 Antibody [NBP1-88982] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: RHOT2 Antibody [NBP1-88982] - Staining of human Liver shows moderate granular cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/RHOT2-Antibody-Immunohistochemistry-Paraffin-NBP1-88982-img0014.jpg "Immunohistochemistry-Paraffin: RHOT2 Antibody [NBP1-88982] - Staining of human Liver shows moderate granular cytoplasmic positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: RHOT2 Antibody [NBP1-88982] - Staining of human Cerebral cortex shows moderate granular cytoplasmic positivity in neuronal cells.](http://images.novusbio.com/fullsize/RHOT2-Antibody-Immunohistochemistry-Paraffin-NBP1-88982-img0012.jpg "Immunohistochemistry-Paraffin: RHOT2 Antibody [NBP1-88982] - Staining of human Cerebral cortex shows moderate granular cytoplasmic positivity in neuronal cells.")
![Immunohistochemistry-Paraffin: RHOT2 Antibody [NBP1-88982] - Staining of human Heart muscle shows moderate granular cytoplasmic positivity in cardiomyocytes.](http://images.novusbio.com/fullsize/RHOT2-Antibody-Immunohistochemistry-Paraffin-NBP1-88982-img0013.jpg "Immunohistochemistry-Paraffin: RHOT2 Antibody [NBP1-88982] - Staining of human Heart muscle shows moderate granular cytoplasmic positivity in cardiomyocytes.")
![Immunohistochemistry-Paraffin: RHOT2 Antibody [NBP1-88982] - Staining of human Skeletal muscle shows moderate granular cytoplasmic positivity in myocytes.](http://images.novusbio.com/fullsize/RHOT2-Antibody-Immunohistochemistry-Paraffin-NBP1-88982-img0015.jpg "Immunohistochemistry-Paraffin: RHOT2 Antibody [NBP1-88982] - Staining of human Skeletal muscle shows moderate granular cytoplasmic positivity in myocytes.")
![Simple Western: RHOT2 Antibody [NBP1-88982] - Simple Western lane view shows a specific band for RHOT2 in 0.2 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://images.novusbio.com/fullsize/RHOT2-Antibody-Simple-Western-NBP1-88982-img0007.jpg "Simple Western: RHOT2 Antibody [NBP1-88982] - Simple Western lane view shows a specific band for RHOT2 in 0.2 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.")
![Simple Western: RHOT2 Antibody [NBP1-88982] - Electropherogram image(s) of corresponding Simple Western lane view. RHOT2 antibody was used at 1:20 dilution on RT-4 and U-251MG lysate(s).](http://images.novusbio.com/fullsize/RHOT2-Antibody-Simple-Western-NBP1-88982-img0008.jpg "Simple Western: RHOT2 Antibody [NBP1-88982] - Electropherogram image(s) of corresponding Simple Western lane view. RHOT2 antibody was used at 1:20 dilution on RT-4 and U-251MG lysate(s).")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")