![Western Blot: RECQL5 Antibody [NBP1-83438] - Analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-RECQL5 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.](http://images.novusbio.com/fullsize/RECQL5-Antibody-Western-Blot-NBP1-83438-img0014.jpg "Western Blot: RECQL5 Antibody [NBP1-83438] - Analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-RECQL5 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ELEHETFRNAKVANLYKASVLKKVADIHRASKDGQPYDMGGSAKSCSAQAEPPEPNEYDIPPASHVYSLKPKRVGAGFPKGSCPFQTATELMETTRIREQ |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RECQL5 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RECQL5 |
![Immunocytochemistry/Immunofluorescence: RECQL5 Antibody [NBP1-83438] - Staining of human cell line A-431 shows localization to nucleus & cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/RECQL5-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83438-img0007.jpg "Immunocytochemistry/Immunofluorescence: RECQL5 Antibody [NBP1-83438] - Staining of human cell line A-431 shows localization to nucleus & cytosol. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: RECQL5 Antibody [NBP1-83438] - Staining of human placenta shows no positivity in stromal cells as expected.](http://images.novusbio.com/fullsize/RECQL5-Antibody-Immunohistochemistry-Paraffin-NBP1-83438-img0012.jpg "Immunohistochemistry-Paraffin: RECQL5 Antibody [NBP1-83438] - Staining of human placenta shows no positivity in stromal cells as expected.")
![Immunohistochemistry-Paraffin: RECQL5 Antibody [NBP1-83438] - Staining of human testis shows moderate to strong nuclear positivity in squamous epithelial cells.](http://images.novusbio.com/fullsize/RECQL5-Antibody-Immunohistochemistry-Paraffin-NBP1-83438-img0009.jpg "Immunohistochemistry-Paraffin: RECQL5 Antibody [NBP1-83438] - Staining of human testis shows moderate to strong nuclear positivity in squamous epithelial cells.")
![Immunohistochemistry-Paraffin: RECQL5 Antibody [NBP1-83438] - Staining of human cervix, uterine shows moderate to strong nuclear positivity in squamous epithelial cells.](http://images.novusbio.com/fullsize/RECQL5-Antibody-Immunohistochemistry-Paraffin-NBP1-83438-img0010.jpg "Immunohistochemistry-Paraffin: RECQL5 Antibody [NBP1-83438] - Staining of human cervix, uterine shows moderate to strong nuclear positivity in squamous epithelial cells.")
![Immunohistochemistry-Paraffin: RECQL5 Antibody [NBP1-83438] - Staining of human cerebral cortex shows moderate to strong nuclear positivity in neurons.](http://images.novusbio.com/fullsize/RECQL5-Antibody-Immunohistochemistry-Paraffin-NBP1-83438-img0011.jpg "Immunohistochemistry-Paraffin: RECQL5 Antibody [NBP1-83438] - Staining of human cerebral cortex shows moderate to strong nuclear positivity in neurons.")
![Western Blot Chk2 [p Thr68] Antibody [Unconjugated]](https://images.novusbio.com/images2/Chk2_AF1626_Western_Blot_5130.jpg)
![Immunocytochemistry Chk2 [p Thr68] Antibody [Unconjugated]](https://images.novusbio.com/images2/Chk2_AF1626_Immunocytochemistry__Immunofluorescence_18847.jpg)
![Jagged 2 [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Jagged 2 [Unconjugated]")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")