Home » RAB3GAP2 » RAB3GAP2 Proteins » RAB3GAP2 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

RAB3GAP2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for RAB3GAP2 Protein (NBP1-84199PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

RAB3GAP2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RAB3GAP2.

Source: E. coli

Amino Acid Sequence: TYEIPRHPGVTEQNEELSILYPAAIVTIDGFSLFQSLRACRNQVAKAAASGNENIQPPPLAYKKWGLQDIDTIIDHASVGIMTLSPFDQMKTA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RAB3GAP2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84199.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RAB3GAP2 Recombinant Protein Antigen

  • DKFZP434D245
  • FLJ14579
  • KIAA0839p150
  • RAB3 GTPase activating protein subunit 2 (non-catalytic)
  • Rab3 GTPase-activating protein 150 kDa subunit
  • rab3 GTPase-activating protein non-catalytic subunit
  • Rab3-GAP p150
  • Rab3-GAP regulatory subunit
  • RAB3GAP150
  • RAB3-GAP150
  • RGAP-iso

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Integrin beta
2/CD18 Antibody [Unco ...
AF1730
Immunocytochemistry Integrin beta 2/CD18 Antibody [Unconjugated]
Immunocytochemistry Integrin beta 2/CD18 Antibody [Unconjugated]
(16 Publications)
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC
Integrin alpha
L/CD11a Antibody (345 ...
MAB3595
Western Blot Integrin alpha L/CD11a Antibody (345913) [Unconjugated]
Simple Western Integrin alpha L/CD11a Antibody (345913) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, Simple Western, WB
CD11b Antibody -
BSA Free
NB110-89474
Immunocytochemistry/ Immunofluorescence CD11b Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence CD11b Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence CD11b Antibody - BSA Free
(12 Reviews)
(114 Publications)
Species: Bv, Ce, ChHa, Hu, Pm, Mu, Rt, RM
Applications: Dual ISH-IHC, Flow-CS, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, ISH, Simple Western, Single-Cell Western, WB
Lymphotoxin beta
R/TNFRSF3 Antibody
AF629
Lymphotoxin beta R/TNFRSF3 Antibody
(10 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, InhibCellGro, WB
CD11c Antibody
(AP-MAB0806) - Azide ...
NB110-97871
Immunohistochemistry-Paraffin CD11c Antibody (AP-MAB0806) - Azide and BSA Free
Immunohistochemistry-Paraffin CD11c Antibody (AP-MAB0806) - Azide and BSA Free
(15 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
ICAM-1/CD54
Antibody [Unconjugate
AF796
Immunohistochemistry ICAM-1/CD54 Antibody [Unconjugated]
Western Blot ICAM-1/CD54 Antibody [Unconjugated]
Western Blot ICAM-1/CD54 Antibody [Unconjugated]
(6 Reviews)
(88 Publications)
Species: Mu
Applications: AdBlk, IHC, WB
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free
(1 Review)
(26 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
CTLA-4
[Unconjugated]
7268-CT
Bioactivity CTLA-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...
NBP2-79843
Protein Array HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Western Blot HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
CDP/CUTL1 Antibody
(2A10)
H00001523-M01
Western Blot CDP/CUTL1 Antibody (2A10)
Immunohistochemistry-Paraffin CDP/CUTL1 Antibody (2A10)
ELISA CDP/CUTL1 Antibody (2A10)
(1 Review)
(4 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
CHAF1A Antibody
(SS 1 1-13)
NB500-207
Western Blot CHAF1A Antibody (SS 1 1-13)
Immunocytochemistry/ Immunofluorescence CHAF1A Antibody (SS 1 1-13)
(11 Publications)
Species: Hu
Applications: ICC/IF, IP, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(817 Publications)
Species: Hu
Applications: BA
ARID2 Antibody
(7311)
NBP2-43567
Immunocytochemistry/ Immunofluorescence ARID2 Antibody (7311)
Western Blot ARID2 Antibody (7311)
Western Blot ARID2 Antibody (7311)
(1 Publication)
Species: Hu, Mu
Applications: ICC/IF, KO, WB
ASCC3 Antibody
NBP1-88829
Immunocytochemistry/ Immunofluorescence ASCC3 Antibody
Immunohistochemistry-Paraffin ASCC3 Antibody
Immunohistochemistry-Paraffin ASCC3 Antibody
(1 Review)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
ARFGEF1 Antibody
NBP1-88840
Immunohistochemistry-Paraffin ARFGEF1 Antibody
Western Blot ARFGEF1 Antibody
Immunohistochemistry-Paraffin ARFGEF1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
CHAF1B Antibody
(SS 53)
NB500-212
Knockdown Validated CHAF1B Antibody (SS 53)
(9 Publications)
Species: Hu
Applications: ICC/IF, IP, KD, WB
CLIP170 Antibody
NBP1-85568
Immunocytochemistry/ Immunofluorescence CLIP170 Antibody
Western Blot CLIP170 Antibody
Immunohistochemistry-Paraffin CLIP170 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
RAB3GAP2
Recombinant Protein A
NBP1-84199PEP
RAB3GAP2 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for RAB3GAP2 Protein (NBP1-84199PEP) (0)

There are no publications for RAB3GAP2 Protein (NBP1-84199PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAB3GAP2 Protein (NBP1-84199PEP) (0)

There are no reviews for RAB3GAP2 Protein (NBP1-84199PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RAB3GAP2 Protein (NBP1-84199PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RAB3GAP2 Products

Research Areas for RAB3GAP2 Protein (NBP1-84199PEP)

Find related products by research area.

Blogs on RAB3GAP2

There are no specific blogs for RAB3GAP2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Immunocytochemistry/Immunofluorescence: CD11b Antibody - BSA Free [NB110-89474] - Raw264.7 cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.05% Triton X-100 in PBS for 5 minutes. The cells were incubated with CD11b Antibody conjugated to Alexa Fluor 488 (NB110-89474AF488) at 5 ug/ml for 1 hour at room temperature. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 100X objective and digitally deconvolved.
CD11b Antibody - BSA Free
NB110-89474

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RAB3GAP2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol RAB3GAP2