![Western Blot: RAB14 Antibody [NBP1-79962] - Host: Rabbit. Target Name: RAB14. Sample Tissue: Human HepG2 Whole Cell. Antibody Dilution: 1ug/ml](http://images.novusbio.com/fullsize/RAB14-Antibody-Western-Blot-NBP1-79962-img0007.jpg "Western Blot: RAB14 Antibody [NBP1-79962] - Host: Rabbit. Target Name: RAB14. Sample Tissue: Human HepG2 Whole Cell. Antibody Dilution: 1ug/ml")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 0.5 mg/ml |
| Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen | Synthetic peptide directed towards the C terminal of human RAB14The immunogen for this antibody is RAB14. Peptide sequence FLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQREGCG. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RAB14 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 24 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
![Flow Cytometry FOLR1 Antibody (548908) [Unconjugated]](https://images.novusbio.com/images2/FOLR1_MAB5646_Flow_Cytometry_10781.jpg)
![Western Blot FOLR1 Antibody (548908) [Unconjugated]](https://images.novusbio.com/images2/FOLR1_MAB5646_Western_Blot_6248.jpg)
![Immunocytochemistry FOLR1 Antibody (548908) [Unconjugated]](https://images.novusbio.com/images2/FOLR1_MAB5646_Immunocytochemistry_6624.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for RAB14 Antibody (NBP1-79962)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: RAB14 Antibody [NBP1-79962] - Lanes: Murin JAWS-II cell line Primary Antibody Dilution: 1:100 Secondary Antibody: Anti-rabbit-FITC Secondary Antibody Dilution: 1:1000 Gene Name: Blue: Nucleus Green: Rab14 Submitted by: RAB14](http://images.novusbio.com/fullsize/RAB14-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-79962-img0006.jpg "Immunocytochemistry/Immunofluorescence: RAB14 Antibody [NBP1-79962] - Lanes: Murin JAWS-II cell line Primary Antibody Dilution: 1:100 Secondary Antibody: Anti-rabbit-FITC Secondary Antibody Dilution: 1:1000 Gene Name: Blue: Nucleus Green: Rab14 Submitted by: RAB14")
![Western Blot: RAB14 Antibody [NBP1-79962] - 1. Human Cervical Cancer Cell Lysate (15ug) 2. Monkey Fibroblast Cell Lysate (15ug) 3. Human Cervical Cancer Cell transfected with mouse Rab14-GFP (15ug) at 1:1000.](http://images.novusbio.com/fullsize/RAB14-Antibody-Western-Blot-NBP1-79962-img0002.jpg "Western Blot: RAB14 Antibody [NBP1-79962] - 1. Human Cervical Cancer Cell Lysate (15ug) 2. Monkey Fibroblast Cell Lysate (15ug) 3. Human Cervical Cancer Cell transfected with mouse Rab14-GFP (15ug) at 1:1000.")
![Western Blot: RAB14 Antibody [NBP1-79962] - Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.](http://images.novusbio.com/fullsize/RAB14-Antibody-Western-Blot-NBP1-79962-img0003.jpg "Western Blot: RAB14 Antibody [NBP1-79962] - Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.")
![Western Blot: RAB14 Antibody [NBP1-79962] - Sample Tissue: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.0ug/mL, Peptide Concentration: 2.0ug/mL, Lysate Quantity: 25ug/lane, Gel Concentration: 12%](http://images.novusbio.com/fullsize/RAB14-Antibody-Western-Blot-NBP1-79962-img0004.jpg "Western Blot: RAB14 Antibody [NBP1-79962] - Sample Tissue: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.0ug/mL, Peptide Concentration: 2.0ug/mL, Lysate Quantity: 25ug/lane, Gel Concentration: 12%")
![Western Blot: RAB14 Antibody [NBP1-79962] - Sample Tissue: Human Fetal Liver Antibody Dilution: 1.0 ug/ml](http://images.novusbio.com/fullsize/RAB14-Antibody-Western-Blot-NBP1-79962-img0005.jpg "Western Blot: RAB14 Antibody [NBP1-79962] - Sample Tissue: Human Fetal Liver Antibody Dilution: 1.0 ug/ml")
![Western Blot Lyp/PTPN22 Antibody [Unconjugated]](https://images.novusbio.com/images2/Lyp_AF3428_Western_Blot_5296.jpg)
![Simple Western Lyp/PTPN22 Antibody [Unconjugated]](https://images.novusbio.com/images2/Lyp_AF3428_Simple_Western_16762.jpg)
![Immunocytochemistry Lyp/PTPN22 Antibody [Unconjugated]](https://images.novusbio.com/images2/Lyp_AF3428_Immunocytochemistry__Immunofluorescence_17421.jpg)
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Holo-Transferrin [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Holo-Transferrin [Unconjugated]")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")