![Immunohistochemistry-Paraffin: PSMA/FOLH1/NAALADase I Antibody [NBP1-89822] - Analysis in human prostate and pancreas tissues using NBP1-89822 antibody. Corresponding FOLH1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/PSMA-FOLH1-NAALADase-I-Antibody-Immunohistochemistry-Paraffin-NBP1-89822-img0013.jpg "Immunohistochemistry-Paraffin: PSMA/FOLH1/NAALADase I Antibody [NBP1-89822] - Analysis in human prostate and pancreas tissues using NBP1-89822 antibody. Corresponding FOLH1 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, RtSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNF |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | FOLH1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunohistochemistry_20892.jpg)
![Immunocytochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunocytochemistry__Immunofluorescence_21143.jpg)
![Western Blot EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Western_Blot_19925.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for PSMA/FOLH1/NAALADase I Antibody (NBP1-89822)Find related products by research area.
|
|
Taking Biomarker Discovery From 2D to 3D: Increased Biological Activity of EVs Isolated From 3D Prostate Cancer Cultures Jamshed Arslan, Pharm D, PhD Tissues within the human body are made of a three-dimensional (3D) arrangement of cells working together to perform vital functions. The commonly used 2D monolayer cultures have limited ... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: PSMA/FOLH1/NAALADase I Antibody [NBP1-89822] - Staining of human duodenum shows moderate positivity in apical membrane in glandular cells.](http://images.novusbio.com/fullsize/PSMA-FOLH1-NAALADase-I-Antibody-Immunohistochemistry-Paraffin-NBP1-89822-img0009.jpg "Immunohistochemistry-Paraffin: PSMA/FOLH1/NAALADase I Antibody [NBP1-89822] - Staining of human duodenum shows moderate positivity in apical membrane in glandular cells.")
![Immunohistochemistry-Paraffin: PSMA/FOLH1/NAALADase I Antibody [NBP1-89822] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.](http://images.novusbio.com/fullsize/PSMA-FOLH1-NAALADase-I-Antibody-Immunohistochemistry-Paraffin-NBP1-89822-img0010.jpg "Immunohistochemistry-Paraffin: PSMA/FOLH1/NAALADase I Antibody [NBP1-89822] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.")
![Immunohistochemistry-Paraffin: PSMA/FOLH1/NAALADase I Antibody [NBP1-89822] - Staining of human placenta shows no positivity in trophoblastic cells as expected.](http://images.novusbio.com/fullsize/PSMA-FOLH1-NAALADase-I-Antibody-Immunohistochemistry-Paraffin-NBP1-89822-img0011.jpg "Immunohistochemistry-Paraffin: PSMA/FOLH1/NAALADase I Antibody [NBP1-89822] - Staining of human placenta shows no positivity in trophoblastic cells as expected.")
![Immunohistochemistry-Paraffin: PSMA/FOLH1/NAALADase I Antibody [NBP1-89822] - Staining of human prostate shows strong positivity in apical membrane in glandular cells.](http://images.novusbio.com/fullsize/PSMA-FOLH1-NAALADase-I-Antibody-Immunohistochemistry-Paraffin-NBP1-89822-img0012.jpg "Immunohistochemistry-Paraffin: PSMA/FOLH1/NAALADase I Antibody [NBP1-89822] - Staining of human prostate shows strong positivity in apical membrane in glandular cells.")
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/DATA_Kallikrein_3_DKK300_ELISA_729.jpg)
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/DATA_Kallikrein_3_DKK300_ELISA_730.jpg)
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/Kallikrein_3_DKK300_ELISA_124.jpg)
![Western Blot Protein S/PROS1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Protein_S_AF4036_Western_Blot_17082.jpg)
![Simple Western Protein S/PROS1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Protein_S_AF4036_Simple_Western_18689.jpg)
![Western Blot Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) - BSA Free](https://images.novusbio.com/images/Androgen-R-NR3C4-p-Ser213-p-Ser210-Antibody-156C135-2-Western-Blot-NB100-56603-img0004.jpg)
![Western Blot Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]](https://images.novusbio.com/images2/Prostatic_Acid_Phosphatase_AF6240_Western_Blot_10680.jpg)
![Immunohistochemistry Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]](https://images.novusbio.com/images2/Prostatic_Acid_Phosphatase_AF6240_Immunohistochemistry_10732.jpg)
![ELISA Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]](https://images.novusbio.com/images2/Prostatic_Acid_Phosphatase_AF6240_ELISA_22233.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")