Home » PP14/Glycodelin » PP14 Peptides and Proteins » PP14/Glycodelin Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

PP14/Glycodelin Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for PP14/Glycodelin Recombinant Protein Antigen (NBP1-89782PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

PP14/Glycodelin Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PAEP.

Source: E. coli

Amino Acid Sequence: NYTVANEATLLDTDYDNFLFLCLQDTTTPIQSMMCQYLARVLVEDDEIMQGFIRAFRPLPRHLWYLLDLKQME

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PAEP
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89782.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PP14/Glycodelin Recombinant Protein Antigen

  • alpha uterine protein
  • GdF
  • GdS
  • Glycodelin
  • glycodelin-A
  • glycodelin-F
  • glycodelin-S
  • MGC138509
  • MGC142288
  • PAEP
  • PEP
  • Placental protein 14
  • PP14 protein (placental protein 14)
  • PP14
  • PP14GDPAEGGdA
  • pregnancy-associated endometrial a
  • Pregnancy-associated endometrial alpha-2 globulin
  • pregnancy-associated endometrial alpha-2-globulin
  • progestagen-associated endometrial protein (placental protein 14
  • progestagen-associated endometrial proteinPEG
  • Progesterone-associated endometrial protein

Background

PAEP (Progesterone-associated endometrial protein, glycodelin, PEG, PP14) is a glycoprotein belonging to lipocalin structural superfamily. It shares a sequence homology to beta-lactoglobulins containing a retinol-binding motif and it is mainly produced by secretory and decidualized endometrium in women and by seminal vesicle epithelium in men (1). PAEP function is not clearly understood. However, glycosylated version of PAEP (GdA) has been associated to contraceptive and immunosuppressive activities during reproduction. PAEP is the main protein produced by secretory endometrium during mid-luteal phase of the menstrual cycle and during the first semester of pregnancy. Therefore, PAEP has been linked as an ideal biomarker of endometrial activity and function for in vitro fertilization treated women (2).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

IGFBP-1 [Biotin]
DY871
N/A IGFBP-1 [Biotin]
(16 Publications)
Species: Hu
Applications: ELISA
Prolyl
Oligopeptidase/PREP A
NBP2-33950
Immunocytochemistry/ Immunofluorescence Prolyl Oligopeptidase/PREP Antibody
Immunohistochemistry-Paraffin Prolyl Oligopeptidase/PREP Antibody
Immunohistochemistry-Paraffin Prolyl Oligopeptidase/PREP Antibody
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(663 Publications)
Species: Mu
Applications: ELISA
PCK2 Antibody
NBP2-33606
Immunocytochemistry/ Immunofluorescence PCK2 Antibody
Immunohistochemistry-Paraffin PCK2 Antibody
Immunohistochemistry-Paraffin PCK2 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(817 Publications)
Species: Hu
Applications: BA
PTS Antibody
NBP1-32975
Western Blot PTS Antibody
Western Blot PTS Antibody
Immunocytochemistry/ Immunofluorescence PTS Antibody
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KO, WB
Progesterone
R/NR3C3 Antibody [Unc ...
AF5415
Immunocytochemistry Progesterone R/NR3C3 Antibody [Unconjugated]
Immunohistochemistry Progesterone R/NR3C3 Antibody [Unconjugated]
Western Blot Progesterone R/NR3C3 Antibody [Unconjugated]
(2 Publications)
Species: Hu
Applications: ICC, IHC, Simple Western, WB
preproANP Antibody
NBP2-14873
Immunohistochemistry-Paraffin preproANP Antibody
Immunohistochemistry-Paraffin preproANP Antibody
Western Blot preproANP Antibody
(6 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
CTLA-4
[Unconjugated]
7268-CT
Bioactivity CTLA-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
CD77 Synthase
Antibody
NBP1-62583
Western Blot CD77 Synthase Antibody
(2 Publications)
Species: Hu
Applications: WB
PCK1 Antibody (3E4)
H00005105-M01
Western Blot PCK1 Antibody (3E4)
Immunocytochemistry/ Immunofluorescence PCK1 Antibody (3E4)
Immunoprecipitation PCK1 Antibody (3E4)
(2 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IP, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
ZAK Antibody (3G5)
H00051776-M03
Western Blot ZAK Antibody (3G5)
Immunocytochemistry/ Immunofluorescence ZAK Antibody (3G5)
Immunohistochemistry-Paraffin ZAK Antibody (3G5)
(3 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Recombinant Human
PRH2 GST (N-Term) Pro ...
H00005555-P01
SDS-PAGE Recombinant Human PRH2 GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
PLOD1 Antibody
NBP2-38770
Western Blot PLOD1 Antibody
Western Blot PLOD1 Antibody
(3 Publications)
Species: Hu, Mu
Applications: IHC-P, WB
IL-2 [Unconjugated]
202-IL
Bioactivity IL-2 [Unconjugated]
(4 Reviews)
(377 Publications)
Species: Hu
Applications: BA
Glutaminyl-peptide
Cyclotransferase/QPCT ...
NBP1-81838
Western Blot Glutaminyl-peptide Cyclotransferase/QPCT Antibody
Immunohistochemistry Glutaminyl-peptide Cyclotransferase/QPCT Antibody
Immunohistochemistry-Paraffin Glutaminyl-peptide Cyclotransferase/QPCT Antibody
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Catalase Antibody
[Unconjugated]
AF3398
Western Blot Catalase Antibody [Unconjugated]
Simple Western Catalase Antibody [Unconjugated]
Knockout Validated Catalase Antibody [Unconjugated]
(3 Reviews)
(15 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
LIF [Unconjugated]
7734-LF
LIF [Unconjugated]
(31 Publications)
Species: Hu
Applications: BA
CD4 Antibody - BSA
Free
NBP1-19371
Immunohistochemistry-Frozen CD4 Antibody - BSA Free
Immunohistochemistry-Paraffin CD4 Antibody - BSA Free
Flow Cytometry CD4 Antibody - BSA Free
(9 Reviews)
(50 Publications)
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB

Publications for PP14/Glycodelin Recombinant Protein Antigen (NBP1-89782PEP) (0)

There are no publications for PP14/Glycodelin Recombinant Protein Antigen (NBP1-89782PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PP14/Glycodelin Recombinant Protein Antigen (NBP1-89782PEP) (0)

There are no reviews for PP14/Glycodelin Recombinant Protein Antigen (NBP1-89782PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PP14/Glycodelin Recombinant Protein Antigen (NBP1-89782PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PP14/Glycodelin Products

Blogs on PP14/Glycodelin

There are no specific blogs for PP14/Glycodelin, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PP14/Glycodelin Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol PAEP