Home » CGB5 » CGB5 Proteins » Recombinant Human CGB5 GST (N-Term) Protein
Novus Biologicals products are now on bio-techne.com

Recombinant Human CGB5 GST (N-Term) Protein

 Submit a Review

Images

 
(
Enlarge)
12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Recombinant Human CGB5 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-165 of Human CGB5

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MEMFQGLLLLLLLSMGGTWASKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
CGB5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
43.89 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CGB5 GST (N-Term) Protein

  • CGB3
  • CG-beta
  • Chorionic gonadotrophin chain beta
  • chorionic gonadotropin beta 5 subunit
  • chorionic gonadotropin, beta polypeptide 5
  • HCG
  • MGC119822

Background

This gene is a member of the glycoprotein hormone beta chain family and encodes the beta 5 subunit of chorionic gonadotropin (CG). Glycoprotein hormones are heterodimers consisting of a common alpha subunit and an unique beta subunit which confers biological specificity. CG is produced by the trophoblastic cells of the placenta and stimulates the ovaries to synthesize the steroids that are essential for the maintenance of pregnancy. The beta subunit of CG is encoded by 6 genes which are arranged in tandem and inverted pairs on chromosome 19q13.3 and contiguous with the luteinizing hormone beta subunit gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

PLOD1 Antibody
NBP2-38770
Western Blot PLOD1 Antibody
Western Blot PLOD1 Antibody
(3 Publications)
Species: Hu, Mu
Applications: IHC-P, WB
BRD2 Antibody
NBP1-30475
Immunohistochemistry-Paraffin BRD2 Antibody
Immunocytochemistry/ Immunofluorescence BRD2 Antibody
Immunoprecipitation BRD2 Antibody
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB

alpha-Fetoprotein/AFP ...
MAB1368
Simple Western alpha-Fetoprotein/AFP Antibody (189502) [Unconjugated]
Knockout Validated alpha-Fetoprotein/AFP Antibody (189502) [Unconjugated]
Knockout Validated alpha-Fetoprotein/AFP Antibody (189502) [Unconjugated]
(3 Reviews)
(90 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow, KO, Simple Western, WB
TRIM26 Antibody
NBP2-47594
Immunocytochemistry/ Immunofluorescence TRIM26 Antibody
Immunohistochemistry-Paraffin TRIM26 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Prolactin Antibody
[Unconjugated]
AF1445
Neutralization Prolactin Antibody [Unconjugated]
Western Blot Prolactin Antibody [Unconjugated]
Immunohistochemistry Prolactin Antibody [Unconjugated]
(7 Publications)
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
Placental
Lactogen/CSH1 Antibod ...
NBP2-46376
Immunohistochemistry Placental Lactogen/CSH1 Antibody (OTI2G4)
Immunohistochemistry Placental Lactogen/CSH1 Antibody (OTI2G4)
Immunohistochemistry Placental Lactogen/CSH1 Antibody (OTI2G4)
Species: Hu
Applications: IHC, IHC-P, WB
CSH2 Antibody
NBP2-16019
Western Blot CSH2 Antibody
Immunohistochemistry-Paraffin CSH2 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
CEACAM5/CD66e
Antibody (CEA31) - Az ...
NBP2-34594
Immunohistochemistry-Paraffin CEACAM5/CD66e Antibody (CEA31) - Azide and BSA Free
Immunohistochemistry-Paraffin CEACAM5/CD66e Antibody (CEA31) - Azide and BSA Free
Immunohistochemistry-Paraffin CEACAM5/CD66e Antibody (CEA31) - Azide and BSA Free
(2 Reviews)
Species: Hu, Pm
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P
CEACAM7 Antibody
[Unconjugated]
AF4478
Immunohistochemistry CEACAM7 Antibody [Unconjugated]
Western Blot CEACAM7 Antibody [Unconjugated]
(1 Publication)
Species: Hu
Applications: IHC, WB
PSG2 Antibody
NBP3-41306
Western Blot PSG2 Antibody
Western Blot PSG2 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
POMC Antibody
NB100-1533
Flow Cytometry POMC Antibody
Immunohistochemistry POMC Antibody
Immunohistochemistry POMC Antibody
(10 Publications)
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
DBT Antibody
NBP1-89522
Immunocytochemistry/ Immunofluorescence DBT Antibody
Immunohistochemistry-Paraffin DBT Antibody
Immunohistochemistry-Paraffin DBT Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Galectin-1
Antibody [Unconjugate
AF1152
Intracellular Staining by Flow Cytometry Galectin-1 Antibody [Unconjugated]
Simple Western Galectin-1 Antibody [Unconjugated]
Immunohistochemistry Galectin-1 Antibody [Unconjugated]
(4 Reviews)
(22 Publications)
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
GnRH Antibody
NBP3-38172
Western Blot GnRH Antibody
Western Blot GnRH Antibody
Immunocytochemistry/ Immunofluorescence GnRH Antibody
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Growth Hormone
Antibody [Unconjugate
AF1067
Western Blot Growth Hormone Antibody [Unconjugated]
ELISA Growth Hormone Antibody [Unconjugated]
Neutralization Growth Hormone Antibody [Unconjugated]
(15 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
PBX1 Antibody (4A2)
H00005087-M01
Western Blot PBX1 Antibody (4A2)
Immunocytochemistry/ Immunofluorescence PBX1 Antibody (4A2)
Immunohistochemistry-Paraffin PBX1 Antibody (4A2)
(12 Publications)
Species: Hu, Pm, Mu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
COCO/DAND5
[Unconjugated]
3047-CC
COCO/DAND5 [Unconjugated]
(4 Publications)
Species: Hu
Applications: BA
SP1 Antibody
NB600-232
Western Blot SP1 Antibody
Immunohistochemistry-Paraffin SP1 Antibody
Western Blot SP1 Antibody
(1 Review)
(7 Publications)
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB

Publications for CGB5 Recombinant Protein (H00093659-P01) (0)

There are no publications for CGB5 Recombinant Protein (H00093659-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CGB5 Recombinant Protein (H00093659-P01) (0)

There are no reviews for CGB5 Recombinant Protein (H00093659-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CGB5 Recombinant Protein (H00093659-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CGB5 Products

Array H00093659-P01

Research Areas for CGB5 Recombinant Protein (H00093659-P01)

Find related products by research area.

Blogs on CGB5

There are no specific blogs for CGB5, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CGB5 GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol CGB5