Novus Biologicals products are now on bio-techne.com

Plexin A1 Recombinant Protein Antigen

Name: Plexin A1 Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP1-82544PEP
Price: 279 USD

Images

There are currently no images for Plexin A1 Protein (NBP1-82544PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Plexin A1 Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PLXNA1. Source: E. coli Amino Acid Sequence: QDFNQPLGGTVTIEGTPLFVDKDDGLTAVAAYDYRGRTVVFAGTRSGRIRKILVDLSNPGGRPALAYESVVAQEGSPILRDLVLSPNHQYLYAMTEKQVT Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	PLXNA1
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82544. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com For further blocking peptide related information and a protocol, click here.
Theoretical MW	28 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Plexin A1 Recombinant Protein Antigen

NOV
NOVP
Plexin A1
PLEXIN-A1
PLXN1
PLXNA1

Background

Coreceptor for SEMA3A, SEMA3C, SEMA3F and SEMA6D. Necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. Plays a role in axon guidance, invasive growth and cell migration. Class 3 semaphorins bind to a complex composed of a neuropilin and a plexin. The plexin modulates the affinity of the complex for specific semaphorins, and its cytoplasmic domain is required for the activation of down-stream signaling events in the cytoplasm

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Catalase Antibody
[Unconjugated]

AF3398

Simple Western Catalase Antibody [Unconjugated]

Knockout Validated Catalase Antibody [Unconjugated]

(3 Reviews)

(15 Publications)

Species: Hu, Mu, Rt

Applications: ICC, KO, Simple Western, WB

BBS9 Antibody

NBP1-88927

(3 Publications)

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P, WB

LMOD1 Antibody

NBP1-89396

Immunohistochemistry-Paraffin LMOD1 Antibody

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

CTGF/CCN2 Antibody
[Unconjugated] - C-te ...

AF660

Western Blot CTGF/CCN2 Antibody [Unconjugated] - C-terminus

(7 Publications)

Species: Hu

Applications: IHC

TAF9 Antibody -
BSA Free

NBP2-41266

Species: Hu, Mu, Rt

Applications: ELISA, ICC/IF, IHC, IHC-P, WB

HSP60 Antibody -
BSA Free

NBP1-77397

(4 Reviews)

(6 Publications)

Species: Hu, Mu

Applications: Flow, IB, ICC/IF, IHC, IHC-P, KD, Simple Western, WB

CBS Antibody

NBP1-33518

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, IP, KD, KO, WB

Rad51 Antibody
(14B4)

NB100-148

(5 Reviews)

(63 Publications)

Species: Ch, Hu, Mu, Rt

Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, PLA, WB

TEAD1 Antibody -
Azide and BSA Free

NBP2-94035

Immunocytochemistry/ Immunofluorescence TEAD1 Antibody - Azide and BSA Free

Western Blot TEAD1 Antibody - Azide and BSA Free

Species: Hu, Mu, Rt

Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB

Cyr61/CCN1
Antibody [Unconjugate

AF4055

Immunohistochemistry Cyr61/CCN1 Antibody [Unconjugated]

Simple Western Cyr61/CCN1 Antibody [Unconjugated]

(13 Publications)

Species: Mu

Applications: IHC, Simple Western, WB

DIO2 Antibody

NBP1-00178

Immunocytochemistry/ Immunofluorescence DIO2 Antibody

Immunohistochemistry-Frozen DIO2 Antibody

(8 Publications)

Species: Hu, Mu, Sh

Applications: Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, WB

HIST1H4F
Overexpression Lysate

NBP2-07996

Species: Hu

Applications: WB

H4/n Antibody
(3E7H2) - BSA Free

NBP2-52486

Western Blot H4/n Antibody (3E7H2) - BSA Free

Flow Cytometry H4/n Antibody (3E7H2) - BSA Free

Species: Hu

Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB

Histamine H4R
Antibody - BSA Free

NLS3775

(2 Publications)

Species: Hu, Pm

Applications: ICC/IF, IHC, IHC-P

Semaphorin 3A
[Unconjugated]

1250-S3

(34 Publications)

Species: Hu

Applications: BA, BA

CCDC6 Antibody

NBP1-85351

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

TOP2A Antibody

NBP1-86928

(1 Review)

(2 Publications)

Species: Hu

Applications: IHC, IHC-P, WB

Complement
Component C2 Antibody ...

AF1936

(1 Publication)

Species: Hu

Applications: IP, WB

Neuropilin-1
Antibody [Unconjugate

AF566

Western Blot Neuropilin-1 Antibody [Unconjugated]

(10 Reviews)

(108 Publications)

Species: Mu, Rt

Applications: Block, CyTOF-ready, Flow, IHC, WB

Plexin A1
Recombinant Protein A

NBP1-82544PEP

Species: Hu

Applications: AC

Publications for Plexin A1 Protein (NBP1-82544PEP) (0)

There are no publications for Plexin A1 Protein (NBP1-82544PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Plexin A1 Protein (NBP1-82544PEP) (0)

There are no reviews for Plexin A1 Protein (NBP1-82544PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Plexin A1 Protein (NBP1-82544PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Plexin A1 Products

Research Areas for Plexin A1 Protein (NBP1-82544PEP)

Find related products by research area.

Blogs on Plexin A1

There are no specific blogs for Plexin A1, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Neuropilin‑1 was detected in immersion fixed paraffin-embedded sections of rat brain (hippocampus) using Goat Anti-Mouse/Rat Neuropilin‑1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF566) at 3 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC004). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm in neuronal cell bodies and projections. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.

Neuropilin-1 Antibody [Unconjugated]
AF566

Rad51 Antibody (14B4)
NB100-148

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our Plexin A1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

PLXNA1

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Plexin A1 Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

Plexin A1 Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for Plexin A1 Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for Plexin A1 Protein (NBP1-82544PEP) (0)

Reviews for Plexin A1 Protein (NBP1-82544PEP) (0)

FAQs for Plexin A1 Protein (NBP1-82544PEP) (0)

Additional Plexin A1 Products

Research Areas for Plexin A1 Protein (NBP1-82544PEP)

Blogs on Plexin A1

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics