![Western Blot: PLEKHA7 Antibody [NBP1-85045] - Analysis in control (vector only transfected HEK293T lysate) and PLEKHA7 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/PLEKHA7-Antibody-Western-Blot-NBP1-85045-img0007.jpg "Western Blot: PLEKHA7 Antibody [NBP1-85045] - Analysis in control (vector only transfected HEK293T lysate) and PLEKHA7 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SSLKRDMEKVERQAVPQANHTESCHECGRVGPGHTRDCPHRGHDDIVNFERQEQEGEQYRSQRDPLEGKRDRSKARSPYSPAEEDALFMDLPTGP |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PLEKHA7 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | WB, ICC/IF reported in scientific literature (PMID: 23990464). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_15885.jpg)
![Immunohistochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunohistochemistry_15886.jpg)
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_16572.jpg)
| Publication using NBP1-85045 | Applications | Species |
|---|---|---|
| Kurita S, Yamada T, Rikitsu E et al. Binding between the Junctional Proteins Afadin and PLEKHA7 and Implication in the Formation of Adherens Junction in Epithelial Cells. J Biol Chem 2013-10-11 [PMID: 23990464] (ICC/IF, WB, Human) | ICC/IF, WB | Human |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PLEKHA7 |
![Immunocytochemistry/Immunofluorescence: PLEKHA7 Antibody [NBP1-85045] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus, cytosol & cell junctions.](http://images.novusbio.com/fullsize/PLEKHA7-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85045-img0008.jpg "Immunocytochemistry/Immunofluorescence: PLEKHA7 Antibody [NBP1-85045] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus, cytosol & cell junctions.")
![Immunohistochemistry-Paraffin: PLEKHA7 Antibody [NBP1-85045] - Staining of human prostate shows moderate to strong cytoplasmic positivity in smooth muscle cells.](http://images.novusbio.com/fullsize/PLEKHA7-Antibody-Immunohistochemistry-Paraffin-NBP1-85045-img0012.jpg "Immunohistochemistry-Paraffin: PLEKHA7 Antibody [NBP1-85045] - Staining of human prostate shows moderate to strong cytoplasmic positivity in smooth muscle cells.")
![Immunohistochemistry-Paraffin: PLEKHA7 Antibody [NBP1-85045] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/PLEKHA7-Antibody-Immunohistochemistry-Paraffin-NBP1-85045-img0009.jpg "Immunohistochemistry-Paraffin: PLEKHA7 Antibody [NBP1-85045] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: PLEKHA7 Antibody [NBP1-85045] - Staining of human kidney shows moderate cytoplasmic and membranous positivity in cells in tubules.](http://images.novusbio.com/fullsize/PLEKHA7-Antibody-Immunohistochemistry-Paraffin-NBP1-85045-img0010.jpg "Immunohistochemistry-Paraffin: PLEKHA7 Antibody [NBP1-85045] - Staining of human kidney shows moderate cytoplasmic and membranous positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: PLEKHA7 Antibody [NBP1-85045] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells and in islets of Langerhans.](http://images.novusbio.com/fullsize/PLEKHA7-Antibody-Immunohistochemistry-Paraffin-NBP1-85045-img0011.jpg "Immunohistochemistry-Paraffin: PLEKHA7 Antibody [NBP1-85045] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells and in islets of Langerhans.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")