![Western Blot: CACNB2 Antibody (6C4) [H00000783-M05] - Analysis of CACNB2 expression in NIH/3T3 (Cat # L018V1).](http://images.novusbio.com/fullsize/CACNB2-Antibody-6C4-Western-Blot-H00000783-M05-img0006.jpg "Western Blot: CACNB2 Antibody (6C4) [H00000783-M05] - Analysis of CACNB2 expression in NIH/3T3 (Cat # L018V1).")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ELISA |
| Clone | 6C4 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | CACNB2 (NP_963890, 213 a.a. ~ 301 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PSSRKSTPPSSAIDIDATGLDAEENDIPANHRSPKPSANSVTSPHSKEKRMPFFKKTEHTPPYDVVPSMRPVVLVGPSLKGYEVTDMMQ |
| Specificity | CACNB2 - calcium channel, voltage-dependent, beta 2 subunit |
| Isotype | IgG2b Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | CACNB2 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA. |
|
| Reviewed Applications |
|
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Anmol Kumar |
WB | Human | 06/06/2018 |
Summary
|
||||||||
Enlarge |
reviewed by:
Abby Sewell |
WB | Human | 12/01/2014 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for CACNB2 Antibody (H00000783-M05)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
| Anmol Kumar 06/06/2018 |
||
| Application: | WB | |
| Species: | Human |
| Abby Sewell 12/01/2014 |
||
| Application: | WB | |
| Species: | Human |
![Western Blot: CACNB2 Antibody (6C4) [H00000783-M05] - analysis of CACNB2 in HEK293 and CHO whole cell lysates using anti-CACNB2 antibody. Image from verified customer review.](http://images.novusbio.com/fullsize/CACNB2-Antibody-6C4-Western-Blot-H00000783-M05-img0004.jpg "Western Blot: CACNB2 Antibody (6C4) [H00000783-M05] - analysis of CACNB2 in HEK293 and CHO whole cell lysates using anti-CACNB2 antibody. Image from verified customer review.")
![Western Blot: CACNB2 Antibody (6C4) [H00000783-M05] - Analysis of CACNB2 expression in Hela S3 NE (Cat # L013V3).](http://images.novusbio.com/fullsize/CACNB2-Antibody-6C4-Western-Blot-H00000783-M05-img0005.jpg "Western Blot: CACNB2 Antibody (6C4) [H00000783-M05] - Analysis of CACNB2 expression in Hela S3 NE (Cat # L013V3).")
![Western Blot: CACNB2 Antibody (6C4) [H00000783-M05] - Primary antibody dilution-1:1000 in blocking buffer, 5% Milk in TBS-0.05% Tween for 2 hours at RT. Blocking Overnightat +4 degreeC 2 Hours at RT. Secondary antibody: 1:2000 in blocking buffer, 1 hourat RT. Image from verified customer review.](http://images.novusbio.com/fullsize/CACNB2-Antibody-6C4-Western-Blot-H00000783-M05-img0007.jpg "Western Blot: CACNB2 Antibody (6C4) [H00000783-M05] - Primary antibody dilution-1:1000 in blocking buffer, 5% Milk in TBS-0.05% Tween for 2 hours at RT. Blocking Overnightat +4 degreeC 2 Hours at RT. Secondary antibody: 1:2000 in blocking buffer, 1 hourat RT. Image from verified customer review.")
![ELISA: CACNB2 Antibody (6C4) [H00000783-M05] - Detection limit for recombinant GST tagged CACNB2 is approximately 0.03ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/CACNB2-Antibody-6C4-ELISA-H00000783-M05-img0003.jpg "ELISA: CACNB2 Antibody (6C4) [H00000783-M05] - Detection limit for recombinant GST tagged CACNB2 is approximately 0.03ng/ml as a capture antibody.")
![SDS-PAGE LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_719.jpg)
![Bioactivity LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_721.jpg)
![SDS-PAGE ErbB2/Her2 [Unconjugated]](https://images.novusbio.com/images2/ErbB2_1129-ER_70.jpg)
![Bioactivity ErbB2/Her2 [Unconjugated]](https://images.novusbio.com/images2/1129-er_recombinant-human-erbb2-her2-fc-chimera-protein-cf-bioactivity-7122020142841.jpg)
