![Immunohistochemistry-Paraffin: Plakophilin 1 Antibody [NBP1-90042] - Staining in human skin and skeletal muscle tissues using anti-PKP1 antibody. Corresponding PKP1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Plakophilin-1-Antibody-Immunohistochemistry-Paraffin-NBP1-90042-img0008.jpg "Immunohistochemistry-Paraffin: Plakophilin 1 Antibody [NBP1-90042] - Staining in human skin and skeletal muscle tissues using anti-PKP1 antibody. Corresponding PKP1 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: YTVRNLMASQPQLAKQYFSSSMLNNIINLCRSSASPKAAEAARLLLSDMWSSKELQGVLRQQGFDRNMLGTLAGANSLRNFTSRF |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PKP1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/beta-Catenin_AF1329_Western_Blot_5100.jpg)
![Chromatin Immunoprecipitation (ChIP) beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/beta-Catenin_AF1329_Chromatin_Immunoprecipitation_11251.jpg)
![Simple Western beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/betaCatenin_AF1329_Simple_Western_17134.jpg)
| Publication using NBP1-90042 | Applications | Species |
|---|---|---|
| Kaz A, Luo Y, Dzieciatkowski S et al. Aberrantly methylated PKP1 in the progression of Barretts esophagus to esophageal adenocarcinoma. Genes Chromosomes Cancer 2012-04-01 [PMID: 22170739] |
Secondary Antibodies |
Isotype Controls |
Research Areas for Plakophilin 1 Antibody (NBP1-90042)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PKP1 |
![Western Blot: Plakophilin 1 Antibody [NBP1-90042] - Analysis in human cell lines PC-3 and A-549 using anti-PKP1 antibody. Corresponding PKP1 RNA-seq data are presented for the same cell lines. Loading control: anti-PPIB.](http://images.novusbio.com/fullsize/Plakophilin-1-Antibody-Western-Blot-NBP1-90042-img0009.jpg "Western Blot: Plakophilin 1 Antibody [NBP1-90042] - Analysis in human cell lines PC-3 and A-549 using anti-PKP1 antibody. Corresponding PKP1 RNA-seq data are presented for the same cell lines. Loading control: anti-PPIB.")
![Western Blot: Plakophilin 1 Antibody [NBP1-90042] - Analysis using Anti-PKP1 antibody NBP1-90042 (A) shows similar pattern to independent antibody NBP1-90041 (B).](http://images.novusbio.com/fullsize/Plakophilin-1-Antibody-Western-Blot-NBP1-90042-img0010.jpg "Western Blot: Plakophilin 1 Antibody [NBP1-90042] - Analysis using Anti-PKP1 antibody NBP1-90042 (A) shows similar pattern to independent antibody NBP1-90041 (B).")
![Immunocytochemistry/Immunofluorescence: Plakophilin 1 Antibody [NBP1-90042] - Immunofluorescent staining of human cell line PC-3 shows localization to nucleoplasm & plasma membrane.](http://images.novusbio.com/fullsize/Plakophilin-1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-90042-img0005.jpg "Immunocytochemistry/Immunofluorescence: Plakophilin 1 Antibody [NBP1-90042] - Immunofluorescent staining of human cell line PC-3 shows localization to nucleoplasm & plasma membrane.")
![Western Blot: Plakophilin 1 Antibody [NBP1-90042] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/Plakophilin-1-Antibody-Western-Blot-NBP1-90042-img0004.jpg "Western Blot: Plakophilin 1 Antibody [NBP1-90042] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Immunohistochemistry-Paraffin: Plakophilin 1 Antibody [NBP1-90042] - Staining of human skeletal muscle shows low expression as expected.](http://images.novusbio.com/fullsize/Plakophilin-1-Antibody-Immunohistochemistry-Paraffin-NBP1-90042-img0006.jpg "Immunohistochemistry-Paraffin: Plakophilin 1 Antibody [NBP1-90042] - Staining of human skeletal muscle shows low expression as expected.")
![Immunohistochemistry-Paraffin: Plakophilin 1 Antibody [NBP1-90042] - Staining of human skin shows high expression.](http://images.novusbio.com/fullsize/Plakophilin-1-Antibody-Immunohistochemistry-Paraffin-NBP1-90042-img0007.jpg "Immunohistochemistry-Paraffin: Plakophilin 1 Antibody [NBP1-90042] - Staining of human skin shows high expression.")
![Immunohistochemistry Desmoglein-1 Antibody [Unconjugated] - Propeptide](https://images.novusbio.com/images2/Desmoglein-1_AF944_Immunohistochemistry_9801.jpg)
![Simple Western Desmoglein-2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Desmoglein2_AF947_Simple_Western_20740.jpg)
![Western Blot Desmoglein-2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Desmoglein2_AF947_Western_Blot_20147.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")