![Immunohistochemistry-Paraffin: Plakophilin 2 Antibody [NBP1-86078] - Analysis in human heart muscle and liver tissues using NBP1-86078 antibody. Corresponding Plakophilin 2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Plakophilin-2-Antibody-Immunohistochemistry-Paraffin-NBP1-86078-img0025.jpg "Immunohistochemistry-Paraffin: Plakophilin 2 Antibody [NBP1-86078] - Analysis in human heart muscle and liver tissues using NBP1-86078 antibody. Corresponding Plakophilin 2 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VGNGNLHRTSSVPEYVYNLHLVENDFVGGRSPVPKTYDMLKAGTTATYEGRWGRGTAQYSSQKSVEERSLRHPLRRLEISPDSSPERAHYTHSDYQYSQRSQAGHTLHHQESRRAALLVPPRY |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PKP2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Plakophilin 2 Antibody (NBP1-86078)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PKP2 |
![Immunohistochemistry-Paraffin: Plakophilin 2 Antibody [NBP1-86078] - Staining of human heart muscle, liver, prostate and testis using Anti-Plakophilin 2 antibody NBP1-86078 (A) shows similar protein distribution across tissues to independent antibody NBP2-58748 (B).](http://images.novusbio.com/fullsize/Plakophilin-2-Antibody-Immunohistochemistry-Paraffin-NBP1-86078-img0024.jpg "Immunohistochemistry-Paraffin: Plakophilin 2 Antibody [NBP1-86078] - Staining of human heart muscle, liver, prostate and testis using Anti-Plakophilin 2 antibody NBP1-86078 (A) shows similar protein distribution across tissues to independent antibody NBP2-58748 (B).")
![Western Blot: Plakophilin 2 Antibody [NBP1-86078] - Analysis in human cell lines Caco-2 and SK-MEL-30. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.](http://images.novusbio.com/fullsize/Plakophilin-2-Antibody-Western-Blot-NBP1-86078-img0009.jpg "Western Blot: Plakophilin 2 Antibody [NBP1-86078] - Analysis in human cell lines Caco-2 and SK-MEL-30. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.")
![Immunocytochemistry/Immunofluorescence: Plakophilin 2 Antibody [NBP1-86078] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cell junctions. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Plakophilin-2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-86078-img0008.jpg "Immunocytochemistry/Immunofluorescence: Plakophilin 2 Antibody [NBP1-86078] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cell junctions. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: Plakophilin 2 Antibody [NBP1-86078] - Staining of human heart muscle shows strong positivity of intercalated discs.](http://images.novusbio.com/fullsize/Plakophilin-2-Antibody-Immunohistochemistry-Paraffin-NBP1-86078-img0026.jpg "Immunohistochemistry-Paraffin: Plakophilin 2 Antibody [NBP1-86078] - Staining of human heart muscle shows strong positivity of intercalated discs.")
![Immunohistochemistry-Paraffin: Plakophilin 2 Antibody [NBP1-86078] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/Plakophilin-2-Antibody-Immunohistochemistry-Paraffin-NBP1-86078-img0021.jpg "Immunohistochemistry-Paraffin: Plakophilin 2 Antibody [NBP1-86078] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: Plakophilin 2 Antibody [NBP1-86078] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/Plakophilin-2-Antibody-Immunohistochemistry-Paraffin-NBP1-86078-img0022.jpg "Immunohistochemistry-Paraffin: Plakophilin 2 Antibody [NBP1-86078] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: Plakophilin 2 Antibody [NBP1-86078] - Staining of human prostate shows low positivity in glandular cells as expected.](http://images.novusbio.com/fullsize/Plakophilin-2-Antibody-Immunohistochemistry-Paraffin-NBP1-86078-img0023.jpg "Immunohistochemistry-Paraffin: Plakophilin 2 Antibody [NBP1-86078] - Staining of human prostate shows low positivity in glandular cells as expected.")
![Simple Western Desmoglein-2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Desmoglein2_AF947_Simple_Western_20740.jpg)
![Western Blot Desmoglein-2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Desmoglein2_AF947_Western_Blot_20147.jpg)
![Bioactivity TGF-beta 3 [Unconjugated]](https://images.novusbio.com/images/243-b3_recombinant-human-tgf-beta-3-protein-bioactivity-1342023172157.jpg)
![Immunohistochemistry Desmoglein-1 Antibody [Unconjugated] - Propeptide](https://images.novusbio.com/images2/Desmoglein-1_AF944_Immunohistochemistry_9801.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")