How many test can be performed in 0.1 ml of PLA2R1 Antibody (NBP1-84449). Also kindly suggest the secondary Antibody for the same.

Name: PLA2R1 Antibody
Brand: Novus Biologicals
SKU: NBP1-84449
Price: 579 USD

Question

Accepted Answer

The number of tests using NBP1-84449 will depend upon the sample type (differential tissues expression) and the total volume of antibody used in each slide. This product is supplied in 100ul size and the concentration of the antibody is 0.4ug/ul and the working dilution we recommend for IHC is 1:500 to 1:1000, based on this information you should be able to estimate how many experiments can be done with one vial. As far as secondary antibody is concerned, any anti rabbit IgG secondary that is conjugated should technical work, the type of conjugation does not matter as much, HRP is most often used in labs while the biotin-conjugated antibody is used to amplify the signal which results in greater sensitivity than that achieved with an enzyme or fluorescence conjugated secondary antibody alone. Fluorescent labeled antibodies are commonly used for double or multiple staining methods. Here is the list of our secondary antibodies. I can recommend NB730-H as it has received very good reviews from our customers and it has been cited in 23 publications as well. I hope this answers your question. Please do not hesitate to contact us if you have any further questions.

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Reactivity	HuSpecies Glossary
Applications	WB, IHC
Clonality	Polyclonal
Host	Rabbit
Conjugate	Unconjugated

Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids: EEKTWHEALRSCQADNSALIDITSLAEVEFLVTLLGDENASETWIGLSSNKIPVSFEWSNDSSVIFTNWHTLEPHIFPNRSQLCVSAEQSEGHWKVKNCEERLFYICKKAGHVLSDAESGCQEGWERHGGFCYKID
Isotype	IgG
Clonality	Polyclonal
Host	Rabbit
Gene	PLA2R1
Purity	Immunogen affinity purified
Innovator's Reward	Test in a species/application not listed above to receive a full credit towards a future purchase. Learn about the Innovator's Reward

Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer	PBS (pH 7.2) and 40% Glycerol
Preservative	0.02% Sodium Azide
Purity	Immunogen affinity purified

Publications using NBP1-84449	Applications	Species
Ke B, Shen W, Liao Y et al. APC ameliorates idiopathic membranous nephropathy by affecting podocyte apoptosis through the ERK1/2/YB-1/PLA2R1 axis Molecular and cellular biochemistry 2023-01-02 [PMID: 36588134] (WB, Human)	WB	Human
Iwakura T, Ohashi N, Kato A et al. Prevalence of Enhanced Granular Expression of Thrombospondin Type-1 Domain-Containing 7A in the Glomeruli of Japanese Patients with Idiopathic Membranous Nephropathy. PLoS One 2015-01-01 [PMID: 26393352] (IF/IHC, Human)	IF/IHC	Human
Dauvergne M, Moktefi A, Rabant M et al. Membranous Nephropathy Associated With Immunological Disorder-Related Liver Disease: A Retrospective Study of 10 Cases. Medicine (Baltimore) 2015-07-01 [PMID: 26222864] (IF/IHC, Human)	IF/IHC	Human
Akiyama S, Akiyama M, Imai E et al. Prevalence of anti-phospholipase A2 receptor antibodies in Japanese patients with membranous nephropathy. Clin Exp Nephrol 2015-08-01 [PMID: 25412738] (WB, Human)	WB	Human
Augert A, Vindrieux D, Girard CA et al. PLA2R1 kills cancer cells by inducing mitochondrial stress. Free Radic Biol Med 2013-12-01 [PMID: 23994771]
Svobodova B, Honsova E, Ronco P et al. Kidney biopsy is a sensitive tool for retrospective diagnosis of PLA2R-related membranous nephropathy. Nephrol Dial Transplant 2013-07-01 [PMID: 23223223]
Hoxha E, Kneibetaler U, Stege G et al. Enhanced expression of the M-type phospholipase A2 receptor in glomeruli correlates with serum receptor antibodies in primary membranous nephropathy. Kidney Int 2012-10-01 [PMID: 22673885]
Debiec H, Martin L, Jouanneau C et al. Autoantibodies specific for the phospholipase A2 receptor in recurrent and?De Novo?membranous nephropathy. Am J Transplant 2011-10-01 [PMID: 21827616]
Debiec H, Ronco P et al. PLA2R autoantibodies and PLA2R glomerular deposits in membranous nephropathy. N Engl J Med 2011-02-01 [PMID: 21323563]

PLA2R1 Antibody

Species Glossary

Images

Product Details

Order Details

PLA2R1 Antibody Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for PLA2R1 Antibody

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for PLA2R1 Antibody (NBP1-84449)(9)

Reviews for PLA2R1 Antibody (NBP1-84449) (0)

Product General Protocols

Video Protocols

FAQs for PLA2R1 Antibody (NBP1-84449). (Showing 1 - 1 of 1 FAQs).

Secondary Antibodies

Isotype Controls

Additional PLA2R1 Products

Blogs on PLA2R1

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Review this Product

Bioinformatics

Gene Symbol	PLA2R1
Entrez	22925(Human)
Uniprot	Q13018(Human)