Home » Pentraxin 3/TSG-14 » Pentraxin 3/TSG-14 Proteins » Pentraxin 3/TSG-14 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Pentraxin 3/TSG-14 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Pentraxin 3/TSG-14 Recombinant Protein Antigen (NBP2-49595PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Pentraxin 3/TSG-14 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Pentraxin 3/TSG-14.

Source: E. coli

Amino Acid Sequence: GFDETLAFSGRLTGFNIWDSVLSNEEIRETGGAESCHIRGNIVGWGVTEIQPHGGAQYVS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PTX3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49595.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.
Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Pentraxin 3/TSG-14 Recombinant Protein Antigen

  • alpha-induced protein 5
  • pentaxin-related gene, rapidly induced by IL-1 beta, tumor necrosis factor
  • Pentaxin-related protein PTX3
  • Pentraxin 3
  • pentraxin 3, long
  • pentraxin-3
  • pentraxin-related gene, rapidly induced by IL-1 beta
  • pentraxin-related protein PTX3
  • PTX3
  • TNF alpha-induced protein 5
  • TNFAIP5
  • TSG14
  • TSG-14
  • TSG-14pentaxin-related gene, rapidly induced by IL-1 beta
  • Tumor necrosis factor alpha-induced protein 5
  • tumor necrosis factor, alpha-induced protein 5
  • Tumor necrosis factor-inducible gene 14 protein
  • tumor necrosis factor-inducible protein TSG-14

Background

Pentraxin 3 (PTX3) is the prototypic member of the long pentraxin family sharing the C-terminal domain with short pentraxins (C-reactive protein and serum amyloid P component) and containing a unique N-terminal domain. The protein is a soluble pattern recognition receptor and represents a nonredundant component of the humoral innate immunity against selected pathogens. PTX3 is rapidly produced and released at inflammatory sites by diverse cell types including monocytes/macrophages, endothelial cells, vascular smooth muscle cells, fibroblasts, and adipocytes. It interacts with several ligands, including growth factors, extracellular matrix components and selected pathogens. PTX3 has been implicated in vascular damage, angiogenesis, atherosclerosis, and restenosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Pentraxin 2/SAP
Antibody [Unconjugate
AF2558
Western Blot Pentraxin 2/SAP Antibody [Unconjugated]
Simple Western Pentraxin 2/SAP Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu
Applications: Simple Western, WB
C-Reactive
Protein/CRP [Biotin]
DY1707
N/A C-Reactive Protein/CRP [Biotin]
(68 Publications)
Species: Hu
Applications: ELISA
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(810 Publications)
Species: Hu
Applications: BA
CSRP1 Antibody
AF5739
Western Blot CSRP1 Antibody
Species: Hu, Mu, Rt
Applications: WB
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(645 Publications)
Species: Mu
Applications: ELISA
IL-1 beta/IL-1F2
[Unconjugated]
201-LB
SDS-PAGE IL-1 beta/IL-1F2 [Unconjugated]
Bioactivity IL-1 beta/IL-1F2 [Unconjugated]
SEC-MALS IL-1 beta/IL-1F2 [Unconjugated]
(593 Publications)
Species: Hu
Applications: BA
FGF
basic/FGF2/bFGF [Unco
233-FB
FGF basic/FGF2/bFGF [Unconjugated]
(542 Publications)
Species: Hu
Applications: BA
CCL2/JE/MCP-1 [HRP]
DCP00
N/A CCL2/JE/MCP-1 [HRP]
N/A CCL2/JE/MCP-1 [HRP]
N/A CCL2/JE/MCP-1 [HRP]
(254 Publications)
Species: Hu
Applications: ELISA
SH2D1A Antibody
(1C9)
H00004068-M01
Western Blot SH2D1A Antibody (1C9)
Flow Cytometry SH2D1A Antibody (1C9)
ELISA SH2D1A Antibody (1C9)
(1 Review)
(9 Publications)
Species: Hu, Mu
Applications: ELISA, Flow, Func, WB
C1q Antibody
NBP1-87492
Western Blot C1q Antibody
Immunohistochemistry-Paraffin C1q Antibody
Immunohistochemistry-Paraffin C1q Antibody
(2 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
TSG-6 Antibody
(259820)
MAB2104
TSG-6 Antibody (259820)
(2 Reviews)
(6 Publications)
Species: Hu, Mu
Applications: WB
Nurr1/NGFI-B
beta/NR4A2 Antibody [ ...
AF2156
Immunocytochemistry Nurr1/NGFI-B beta/NR4A2 Antibody [Unconjugated]
Immunohistochemistry Nurr1/NGFI-B beta/NR4A2 Antibody [Unconjugated]
(19 Publications)
Species: Hu, Mu
Applications: ICC, IHC, WB
IL-10 [Biotin]
DY417
N/A IL-10 [Biotin]
(298 Publications)
Species: Mu
Applications: ELISA
Complement C3
Antibody (11H9) - BSA ...
NB200-540
Flow Cytometry Complement C3 Antibody (11H9) - BSA Free
Immunocytochemistry/ Immunofluorescence Complement C3 Antibody (11H9) - BSA Free
Immunohistochemistry-Paraffin Complement C3 Antibody (11H9) - BSA Free
(2 Reviews)
(31 Publications)
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NFkB p105/p50
Antibody (2J10D7) - B ...
NB100-56583
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
(1 Review)
(5 Publications)
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
COX-2 Antibody
NB100-689
Immunohistochemistry-Paraffin COX-2 Antibody
Simple Western COX-2 Antibody
(1 Review)
(36 Publications)
Species: Hu, Rt
Applications: IHC, IHC-Fr, IHC-P, Simple Western, WB
FGF-13 Antibody
NBP2-16471
Immunohistochemistry-Paraffin FGF-13 Antibody
Western Blot FGF-13 Antibody
Immunohistochemistry-Paraffin FGF-13 Antibody
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Tyrosine
Hydroxylase Antibody
NB300-109
Immunohistochemistry-Frozen Tyrosine Hydroxylase Antibody
Immunohistochemistry Tyrosine Hydroxylase Antibody
Immunohistochemistry Tyrosine Hydroxylase Antibody
(7 Reviews)
(230 Publications)
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB

Publications for Pentraxin 3/TSG-14 Recombinant Protein Antigen (NBP2-49595PEP) (0)

There are no publications for Pentraxin 3/TSG-14 Recombinant Protein Antigen (NBP2-49595PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Pentraxin 3/TSG-14 Recombinant Protein Antigen (NBP2-49595PEP) (0)

There are no reviews for Pentraxin 3/TSG-14 Recombinant Protein Antigen (NBP2-49595PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Pentraxin 3/TSG-14 Recombinant Protein Antigen (NBP2-49595PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Pentraxin 3/TSG-14 Products

Research Areas for Pentraxin 3/TSG-14 Recombinant Protein Antigen (NBP2-49595PEP)

Find related products by research area.

Blogs on Pentraxin 3/TSG-14

There are no specific blogs for Pentraxin 3/TSG-14, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Pentraxin 3/TSG-14 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol PTX3