PDGF-C Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: LDLLNNAITAFSTLEDLIRYLEPERWQLDLEDLYRPTWQLLGKAFVFGRKSRVVDLNLLTEEVLQLRPKTGVRGLHKSLTDVA |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
PDGFC |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval method is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for PDGF-C Antibody
Background
PDGFC, also known as Platelet-derived growth factor C, has 3 isoforms, a 345 amino acid isoform that is 39 kDa, a 282 amino acid isoform that is 32 kDa and a 167 amino acid isoform that is 19 kDa, expressed in the fallopian tube, vascular smooth muscle cells in kidney, breast and colon and in visceral smooth muscle of the gastrointestinal tract and retinal pigment epithelia; plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis, wound healing, represents potent mitogen for cells of mesenchymal origin, induces macrophage recruitment, increased interstitial pressure, and blood vessel maturation during angiogenesis, can initiate events that lead to a mesangial proliferative glomerulonephritis, including influx of monocytes and macrophages and production of extracellular matrix. This protein is being studied for its involvement in mesangial proliferative glomerulonephritis, proliferative glomerulonephritis, glomerulonephritis, brain cancer, prostate carcinoma, nephropathy, prostatitis, prostate cancer, atherosclerosis, retinitis, melanoma, and carcinoma. The protein has been linked to the cytoskeleton remodeling role of PDGFs in cell migration, development PDGF signaling via MAPK cascades, release of novel PDGFs as latent factors, signal transduction, signaling by PD, focal adhesion, gap junction, regulation of actin cytoskeleton, prostate cancer, and melanoma GF pathways where it interacts with PDGFRB, PDGFRA, PLAT, PLAU, PLAUR, EGFR, ERBB2, FGFR1, FLT1, and FLT4 proteins.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: Block, CyTOF-ready, Flow, IHC, WB
Species: Hu
Applications: ELISA
Species: Mu
Applications: Dual ISH-IHC, IHC, WB
Species: Mu
Applications: Flow, IHC, Neut, WB
Species: Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Neut, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Mu
Applications: CyTOF-ready, Flow, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC
Publications for PDGF-C Antibody (NBP1-83935) (0)
There are no publications for PDGF-C Antibody (NBP1-83935).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PDGF-C Antibody (NBP1-83935) (0)
There are no reviews for PDGF-C Antibody (NBP1-83935).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PDGF-C Antibody (NBP1-83935) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PDGF-C Products
Research Areas for PDGF-C Antibody (NBP1-83935)
Find related products by research area.
|
Blogs on PDGF-C