![Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85886] - Staining in human liver and skin tissues . Corresponding PCCB RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/PCCB-Antibody-Immunohistochemistry-Paraffin-NBP1-85886-img0023.jpg "Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85886] - Staining in human liver and skin tissues . Corresponding PCCB RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, Simple Western, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SSKHLCGDTNYAWPTAEIAVMGAKGAVEIIFKGHENVEAAQAEYIEKFANPFPAAVRGFVDDIIQPSSTRARICCDLDVL |
| Predicted Species | Mouse (94%), Rat (94%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PCCB |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue. |
||
| Theoretical MW | 58 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-85886 | Applications | Species |
|---|---|---|
| Jiang L, Park JS, Yin L et al. Dual mRNA therapy restores metabolic function in long-term studies in mice with propionic acidemia Nat Commun 2020-10-21 [PMID: 33087718] (Human) | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for PCCB Antibody (NBP1-85886)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85886] - Staining of human kidney, liver, salivary gland and tonsil using Anti-PCCB antibody NBP1-85886 (A) shows similar protein distribution across tissues to independent antibody NBP1-85887 (B).](http://images.novusbio.com/fullsize/PCCB-Antibody-Immunohistochemistry-Paraffin-NBP1-85886-img0024.jpg "Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85886] - Staining of human kidney, liver, salivary gland and tonsil using Anti-PCCB antibody NBP1-85886 (A) shows similar protein distribution across tissues to independent antibody NBP1-85887 (B).")
![Western Blot: PCCB Antibody [NBP1-85886] - Analysis using Anti-PCCB antibody NBP1-85886 (A) shows similar pattern to independent antibody NBP1-85887 (B).](http://images.novusbio.com/fullsize/PCCB-Antibody-Western-Blot-NBP1-85886-img0025.jpg "Western Blot: PCCB Antibody [NBP1-85886] - Analysis using Anti-PCCB antibody NBP1-85886 (A) shows similar pattern to independent antibody NBP1-85887 (B).")
![Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85886] - Staining of human kidney using Anti-PCCB antibody NBP1-85886.](http://images.novusbio.com/fullsize/PCCB-Antibody-Immunohistochemistry-Paraffin-NBP1-85886-img0028.jpg "Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85886] - Staining of human kidney using Anti-PCCB antibody NBP1-85886.")
![Western Blot: PCCB Antibody [NBP1-85886] - Analysis in human cell line HepG2.](http://images.novusbio.com/fullsize/PCCB-Antibody-Western-Blot-NBP1-85886-img0017.jpg "Western Blot: PCCB Antibody [NBP1-85886] - Analysis in human cell line HepG2.")
![Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85886] - Staining of human rectum shows strong granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/PCCB-Antibody-Immunohistochemistry-Paraffin-NBP1-85886-img0020.jpg "Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85886] - Staining of human rectum shows strong granular cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85886] - Staining of human skin shows only weak cytoplasmic positivity in a subset of epidermal cells.](http://images.novusbio.com/fullsize/PCCB-Antibody-Immunohistochemistry-Paraffin-NBP1-85886-img0022.jpg "Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85886] - Staining of human skin shows only weak cytoplasmic positivity in a subset of epidermal cells.")
![Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85886] - Staining of human salivary gland.](http://images.novusbio.com/fullsize/PCCB-Antibody-Immunohistochemistry-Paraffin-NBP1-85886-img0026.jpg "Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85886] - Staining of human salivary gland.")
![Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85886] - Staining of human tonsil.](http://images.novusbio.com/fullsize/PCCB-Antibody-Immunohistochemistry-Paraffin-NBP1-85886-img0027.jpg "Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85886] - Staining of human tonsil.")
![Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85886] - Staining of human liver using Anti-PCCB antibody NBP1-85886.](http://images.novusbio.com/fullsize/PCCB-Antibody-Immunohistochemistry-Paraffin-NBP1-85886-img0029.jpg "Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85886] - Staining of human liver using Anti-PCCB antibody NBP1-85886.")
![Simple Western: PCCB Antibody [NBP1-85886] - Simple Western lane view shows a specific band for PCCB in 0.2 mg/ml of RT-4 (left) and U-251MG sp (right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://images.novusbio.com/fullsize/PCCB-Antibody-Simple-Western-NBP1-85886-img0005.jpg "Simple Western: PCCB Antibody [NBP1-85886] - Simple Western lane view shows a specific band for PCCB in 0.2 mg/ml of RT-4 (left) and U-251MG sp (right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.")
![Simple Western: PCCB Antibody [NBP1-85886] - Electropherogram image(s) of corresponding Simple Western lane view. PCCB antibody was used at 1:20 dilution on RT-4 and U-251MG sp lysates(s).](http://images.novusbio.com/fullsize/PCCB-Antibody-Simple-Western-NBP1-85886-img0007.jpg "Simple Western: PCCB Antibody [NBP1-85886] - Electropherogram image(s) of corresponding Simple Western lane view. PCCB antibody was used at 1:20 dilution on RT-4 and U-251MG sp lysates(s).")
![Holo-Transferrin [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Holo-Transferrin [Unconjugated]")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")