![Immunohistochemistry-Paraffin: Pit1 Antibody [NBP1-92273] - Staining of human liver, pancreas, pituitary gland and tonsil using Anti-POU1F1 antibody NBP1-92273 (A) shows similar protein distribution across tissues to independent antibody NBP2-55357 (B).](http://images.novusbio.com/fullsize/Pit1-Antibody-Immunohistochemistry-Paraffin-NBP1-92273-img0009.jpg "Immunohistochemistry-Paraffin: Pit1 Antibody [NBP1-92273] - Staining of human liver, pancreas, pituitary gland and tonsil using Anti-POU1F1 antibody NBP1-92273 (A) shows similar protein distribution across tissues to independent antibody NBP2-55357 (B).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: CKLKAILSKWLEEAEQVGALYNEKVGANERKRKRRTTISIAAKDALERHFGEQNKPSSQEIMRMAE |
| Predicted Species | Rat (97%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | POU1F1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | IHC-P, Retrieval method: HIER pH6 |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Neutralization Prolactin Antibody [Unconjugated]](https://images.novusbio.com/images2/Prolactin_AF1445_Block_Neutralize_8779.jpg)
![Western Blot Prolactin Antibody [Unconjugated]](https://images.novusbio.com/images2/Prolactin_AF1445_Western_Blot_20179.jpg)
![Immunohistochemistry Prolactin Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af1445_mouse-rat-prolactin-affinity-purified-polyclonal-ab-immunohistochemistry-19202393922..jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Pit1 Antibody (NBP1-92273)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | POU1F1 |
![Immunohistochemistry-Paraffin: Pit1 Antibody [NBP1-92273] - Staining of human pituitary gland shows moderate to strong nuclear positivity in neuroendocrine cells in the anterior lobe.](http://images.novusbio.com/fullsize/Pit1-Antibody-Immunohistochemistry-Paraffin-NBP1-92273-img0003.jpg "Immunohistochemistry-Paraffin: Pit1 Antibody [NBP1-92273] - Staining of human pituitary gland shows moderate to strong nuclear positivity in neuroendocrine cells in the anterior lobe.")
![Immunohistochemistry-Paraffin: Pit1 Antibody [NBP1-92273] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/Pit1-Antibody-Immunohistochemistry-Paraffin-NBP1-92273-img0004.jpg "Immunohistochemistry-Paraffin: Pit1 Antibody [NBP1-92273] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: Pit1 Antibody [NBP1-92273] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.](http://images.novusbio.com/fullsize/Pit1-Antibody-Immunohistochemistry-Paraffin-NBP1-92273-img0005.jpg "Immunohistochemistry-Paraffin: Pit1 Antibody [NBP1-92273] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.")
![Immunohistochemistry-Paraffin: Pit1 Antibody [NBP1-92273] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.](http://images.novusbio.com/fullsize/Pit1-Antibody-Immunohistochemistry-Paraffin-NBP1-92273-img0006.jpg "Immunohistochemistry-Paraffin: Pit1 Antibody [NBP1-92273] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.")
![Western Blot Growth Hormone Antibody [Unconjugated]](https://images.novusbio.com/images2/Growth_Hormone_AF1067_Western_Blot_20961.jpg)
![ELISA Growth Hormone Antibody [Unconjugated]](https://images.novusbio.com/images2/Growth_Hormone_AF1067_ELISA_22201.jpg)
![Neutralization Growth Hormone Antibody [Unconjugated]](https://images.novusbio.com/images2/Growth_Hormone_AF1067_Block_Neutralize_8751.jpg)
![SDS-PAGE IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_40.jpg)
![Bioactivity IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_41.jpg)
![Mass Spectrometry IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_42.jpg)
![Immunohistochemistry PITX2 Antibody [Unconjugated]](https://images.novusbio.com/images2/PITX2_AF7388_Immunohistochemistry_12162.jpg)
![Western Blot CBP/KAT3A Antibody (257003) [Unconjugated]](https://images.novusbio.com/images2/CBP_MAB2676_Western_Blot_6043.jpg)
![Immunocytochemistry CBP/KAT3A Antibody (257003) [Unconjugated]](https://images.novusbio.com/images2/mab2676_human-mouse-rat-cbp-mab-clone-257003-immunocytochemistry-101220208237.jpg)
![Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Western_Blot_18923.jpg)
![Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Immunocytochemistry__Immunofluorescence_18945.jpg)
![Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Simple_Western_19175.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")