![Western Blot: MCCC2 Antibody [NBP2-38403] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line RT-4](http://images.novusbio.com/fullsize/MCCC2-Antibody-Western-Blot-NBP2-38403-img0004.jpg "Western Blot: MCCC2 Antibody [NBP2-38403] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line RT-4")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GIAKDGAKMVAAVACAQVPKITLIIGGSYGAGNYGMCGRAYSPRFLYIWPNARISVMGGEQAANVLATITKDQRAREGKQFSSADE |
| Predicted Species | Mouse (90%), Rat (90%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MCCC2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: MCCC2 Antibody [NBP2-38403] - Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.](http://images.novusbio.com/fullsize/MCCC2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38403-img0005.jpg "Immunocytochemistry/Immunofluorescence: MCCC2 Antibody [NBP2-38403] - Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.")
![Immunohistochemistry-Paraffin: MCCC2 Antibody [NBP2-38403] - Staining of human skeletal muscle using Anti-MCCC2 antibody NBP2-38403.](http://images.novusbio.com/fullsize/MCCC2-Antibody-Immunohistochemistry-Paraffin-NBP2-38403-img0013.jpg "Immunohistochemistry-Paraffin: MCCC2 Antibody [NBP2-38403] - Staining of human skeletal muscle using Anti-MCCC2 antibody NBP2-38403.")
![Western Blot: MCCC2 Antibody [NBP2-38403] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: RT-4Lane 3: U-251 MG](http://images.novusbio.com/fullsize/MCCC2-Antibody-Western-Blot-NBP2-38403-img0003.jpg "Western Blot: MCCC2 Antibody [NBP2-38403] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: RT-4Lane 3: U-251 MG")
![Immunohistochemistry-Paraffin: MCCC2 Antibody [NBP2-38403] - Staining of human skeletal muscle shows low expression as expected.](http://images.novusbio.com/fullsize/MCCC2-Antibody-Immunohistochemistry-Paraffin-NBP2-38403-img0007.jpg "Immunohistochemistry-Paraffin: MCCC2 Antibody [NBP2-38403] - Staining of human skeletal muscle shows low expression as expected.")
![Immunohistochemistry-Paraffin: MCCC2 Antibody [NBP2-38403] - Staining in human kidney and skeletal muscle tissues using anti-MCCC2 antibody. Corresponding MCCC2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/MCCC2-Antibody-Immunohistochemistry-Paraffin-NBP2-38403-img0008.jpg "Immunohistochemistry-Paraffin: MCCC2 Antibody [NBP2-38403] - Staining in human kidney and skeletal muscle tissues using anti-MCCC2 antibody. Corresponding MCCC2 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: MCCC2 Antibody [NBP2-38403] - Staining of human kidney, liver, skeletal muscle and skin using Anti-MCCC2 antibody NBP2-38403 (A) shows similar protein distribution across tissues to independent antibody NBP1-82794 (B).](http://images.novusbio.com/fullsize/MCCC2-Antibody-Immunohistochemistry-Paraffin-NBP2-38403-img0009.jpg "Immunohistochemistry-Paraffin: MCCC2 Antibody [NBP2-38403] - Staining of human kidney, liver, skeletal muscle and skin using Anti-MCCC2 antibody NBP2-38403 (A) shows similar protein distribution across tissues to independent antibody NBP1-82794 (B).")
![Immunohistochemistry-Paraffin: MCCC2 Antibody [NBP2-38403] - Staining of human skin.](http://images.novusbio.com/fullsize/MCCC2-Antibody-Immunohistochemistry-Paraffin-NBP2-38403-img0010.jpg "Immunohistochemistry-Paraffin: MCCC2 Antibody [NBP2-38403] - Staining of human skin.")
![Immunohistochemistry-Paraffin: MCCC2 Antibody [NBP2-38403] - Staining of human liver.](http://images.novusbio.com/fullsize/MCCC2-Antibody-Immunohistochemistry-Paraffin-NBP2-38403-img0011.jpg "Immunohistochemistry-Paraffin: MCCC2 Antibody [NBP2-38403] - Staining of human liver.")
![Immunohistochemistry-Paraffin: MCCC2 Antibody [NBP2-38403] - Staining of human kidney using Anti-MCCC2 antibody NBP2-38403.](http://images.novusbio.com/fullsize/MCCC2-Antibody-Immunohistochemistry-Paraffin-NBP2-38403-img0012.jpg "Immunohistochemistry-Paraffin: MCCC2 Antibody [NBP2-38403] - Staining of human kidney using Anti-MCCC2 antibody NBP2-38403.")
![SDS-PAGE LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_719.jpg)
![Bioactivity LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_721.jpg)
![N/A CXCL10/IP-10/CRG-2 [HRP]](https://images.novusbio.com/images2/DATA_CXCL10_DIP100_ELISA_723.jpg)
![N/A CXCL10/IP-10/CRG-2 [HRP]](https://images.novusbio.com/images2/DATA_CXCL10_DIP100_ELISA_724.jpg)
![N/A CXCL10/IP-10/CRG-2 [HRP]](https://images.novusbio.com/images2/CXCL10_DIP100_ELISA_121.jpg)
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Complement Component C2 Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Complement Component C2 Antibody [Unconjugated]")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")