Pappalysin-1/PAPP-A Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: SCLDHNSESIILPMNVTVRDIPHWLNPTRVERVVCTAGLKWYPHPALIHCVKGCEPFMGDNYCDAINNRAFCNYDGGDCCTSTVKTKKVTPFPMSCDLQGDCACRDPQAQEHSRKDL |
Predicted Species |
Mouse (92%), Rat (92%). Backed by our 100% Guarantee. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
PAPPA |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for Pappalysin-1/PAPP-A Antibody
Background
PAPP A was originally isolated from pregnancy serum as heterotetrameric protein complex with molecular weight approximately 500 kDa, consisting of two PAPP A subunits disulfide-linked with two subunits of the proform of eosinophil major basic protein (proMBP). In such a complex proMBP functions as an inhibitor of PAPP A proteinase activity. PAPP A is widely used as a marker of some pathologies during pregnancy. Reduced level of PAPP A in pregnancy blood in the first trimester is associated with fetal Down syndrome. PAPP A is considered as one of the best biochemical markers in early pregnancy used to screen for Down syndrome during the first trimester (Wald, N. J. et al).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow, KO, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: Flow-CS, Flow, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: IHC
Publications for Pappalysin-1/PAPP-A Antibody (NBP1-90087) (0)
There are no publications for Pappalysin-1/PAPP-A Antibody (NBP1-90087).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Pappalysin-1/PAPP-A Antibody (NBP1-90087) (0)
There are no reviews for Pappalysin-1/PAPP-A Antibody (NBP1-90087).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Pappalysin-1/PAPP-A Antibody (NBP1-90087). (Showing 1 - 1 of 1 FAQ).
-
I am highly interested to use couple of Anti-PAPP-A antibodies from your reputed companies for my research work. I have got the information regarding the immunogen used to generate these antibodies, however could not get any information regarding the specific amino acids/epitope to which your Anti-PAPP-A Antibodies binds with the antigen (PAPP-A).
- Unfortunately, none of our PAPP A antibodies have been epitope mapped. Many of them have also been generated against full-length PAPP A, so there are many potential binding sites.
Secondary Antibodies
| |
Isotype Controls
|
Additional Pappalysin-1/PAPP-A Products
Research Areas for Pappalysin-1/PAPP-A Antibody (NBP1-90087)
Find related products by research area.
|
Blogs on Pappalysin-1/PAPP-A