PAK1 interacting protein 1 Antibody Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: GTITNEKRISSVKFLSESVLAVAGDEEVIRFFDCDSLVCLCEFKAHENRVKDMISFEIPEHHVIVSASSDGFIKMWK |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
PAK1IP1 |
Purity |
Protein A purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
Application Notes |
Recommended conditions:
Fixation/Permeabilization: PFA/Triton X-100 |
Control Peptide |
|
Reactivity Notes
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Protein A purified |
Alternate Names for PAK1 interacting protein 1 Antibody
Background
PIP1/WDR84 (PAK1IP1) was identified as a p21-activated protein kinase (PAK) interacting protein that functions as a negative regulator of PAK activity and PAK signaling pathways. PIP1/WDR84 (PAK1IP1) contains 5 G beta-like WD repeats. The WD repeat is defined by four or more repeating units of a conserved core of approximately 40 amino acids ending with tryptophan-aspartic acid (WD). WD repeats may serve as sites of protein-protein interaction for adaptor proteins and facilitate multiprotein complex formation.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, WB
Species: ChHa, Hu, Mu, Pm, Rt
Applications: ChIP, DB, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
Species: Hu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Flow
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, Simple Western, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: WB
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA, S-ELISA, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu
Applications: Flow-CS, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IB, ICC/IF, IHC, IHC-P, IP, WB
Publications for PAK1 interacting protein 1 Antibody (NBP2-68615) (0)
There are no publications for PAK1 interacting protein 1 Antibody (NBP2-68615).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PAK1 interacting protein 1 Antibody (NBP2-68615) (0)
There are no reviews for PAK1 interacting protein 1 Antibody (NBP2-68615).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PAK1 interacting protein 1 Antibody (NBP2-68615) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PAK1 interacting protein 1 Products
Blogs on PAK1 interacting protein 1