![Western Blot: P2X5/P2RX5 Antibody (1C5) [H00005026-M01] - Analysis of P2RX5 expression in transfected 293T cell line by P2RX5 monoclonal antibody (M01), clone 1C5.Lane 1: P2RX5 transfected lysate(46.42 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/P2X5-P2RX5-Antibody-1C5-Western-Blot-H00005026-M01-img0006.jpg "Western Blot: P2X5/P2RX5 Antibody (1C5) [H00005026-M01] - Analysis of P2RX5 expression in transfected 293T cell line by P2RX5 monoclonal antibody (M01), clone 1C5.Lane 1: P2RX5 transfected lysate(46.42 KDa).Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, KD |
| Clone | 1C5 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | P2RX5 (NP_002552, 126 a.a. ~ 224 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DGACSKDSDCHAGEAVTAGNGVKTGRCLRRENLARGTCEIFAWCPLETSSRPEEPFLKEAEDFTIFIKNHIRFPKFNFSKSNVMDVKDRSFLKSCHFGP |
| Localization | Integral membrane protein. |
| Specificity | P2RX5 - purinergic receptor P2X, ligand-gated ion channel, 5 |
| Isotype | IgG1 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | P2RX5 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA and RNAi Validation. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
| Publication using H00005026-M01 | Applications | Species |
|---|---|---|
| Abramowski P, Ogrodowczyk C, Martin R, Pongs O. A Truncation Variant of the Cation Channel P2RX5 Is Upregulated during T Cell Activation. PLoS One. 2014-09-02 [PMID: 25181038] |
Secondary Antibodies |
Isotype Controls |
Research Areas for P2X5/P2RX5 Antibody (H00005026-M01)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: P2X5/P2RX5 Antibody (1C5) [H00005026-M01] - Analysis of P2RX5 over-expressed 293 cell line, cotransfected with P2RX5 Validated Chimera RNAi ( Cat # H00005026-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with P2RX5 monoclonal antibody (M01), clone 1C5 (Cat # H00005026-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.](http://images.novusbio.com/fullsize/P2X5-P2RX5-Antibody-1C5-Western-Blot-H00005026-M01-img0004.jpg "Western Blot: P2X5/P2RX5 Antibody (1C5) [H00005026-M01] - Analysis of P2RX5 over-expressed 293 cell line, cotransfected with P2RX5 Validated Chimera RNAi ( Cat # H00005026-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with P2RX5 monoclonal antibody (M01), clone 1C5 (Cat # H00005026-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.")
![Sandwich ELISA: P2X5/P2RX5 Antibody (1C5) [H00005026-M01] - Detection limit for recombinant GST tagged P2RX5 is approximately 1ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/P2X5-P2RX5-Antibody-1C5-Sandwich-ELISA-H00005026-M01-img0005.jpg "Sandwich ELISA: P2X5/P2RX5 Antibody (1C5) [H00005026-M01] - Detection limit for recombinant GST tagged P2RX5 is approximately 1ng/ml as a capture antibody.")
![Immunocytochemistry CYP7A1 Antibody (946902) [Unconjugated]](https://images.novusbio.com/images2/CYP7A1_MAB9120_Immunocytochemistry__Immunofluorescence_19938.jpg)
![Chromatin Immunoprecipitation (ChIP) Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct-3_4_AF1759_Chromatin_Immunoprecipitation_11218.jpg)
![Immunocytochemistry Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct-3_4_AF1759_Immunocytochemistry_7093.jpg)
![Simple Western Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct3_4_AF1759_Simple_Western_20183.jpg)
![Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.](https://images.novusbio.com/images/Mouse-IgG1-Kappa-Light-Chain-Isotype-Control-P3-6-2-8-1-Flow-Cytometry-NBP1-43319-img0002.jpg "Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.")