Independent Antibodies: Immunohistochemistry-Paraffin: p23/PTGES3 Antibody [NBP1-85485] - Staining of human colon, fallopian tube, kidney and testis using Anti-PTGES3 antibody NBP1-85485 (A) shows similar protein ...read more
Independent Antibodies: Western Blot: p23/PTGES3 Antibody [NBP1-85485] - Analysis using Anti-PTGES3 antibody NBP1-85485 (A) shows similar pattern to independent antibody NBP1-85486 (B).
Western Blot: p23/PTGES3 Antibody [NBP1-85485] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat wistar bladder tumour cells).
Immunocytochemistry/ Immunofluorescence: p23/PTGES3 Antibody [NBP1-85485] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: p23/PTGES3 Antibody [NBP1-85485] - Staining of human kidney.
Immunohistochemistry-Paraffin: p23/PTGES3 Antibody [NBP1-85485] - Staining of human fallopian tube.
Immunohistochemistry-Paraffin: p23/PTGES3 Antibody [NBP1-85485] - Staining of human testis.
Immunohistochemistry-Paraffin: p23/PTGES3 Antibody [NBP1-85485] - Staining of human colon.
This antibody was developed against Recombinant Protein corresponding to amino acids: CVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLT
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PTGES3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified
Alternate Names for p23/PTGES3 Antibody
CPGES
cPGESp23
Cytosolic prostaglandin E2 synthase
Hsp90 co-chaperone
p23
P23cytosolic prostaglandin E synthase
Progesterone receptor complex p23
prostaglandin E synthase 3 (cytosolic)
prostaglandin E synthase 3
PTGES3
TEBP
TEBPEC 5.3.99.3
Telomerase-binding protein p23
unactive progesterone receptor, 23 kD
Background
Steroid receptors are ligand-dependent intracellular proteins that stimulate transcription of specific genes by binding to specific DNA sequences following activation by the appropriate hormone. Prior to activation, steroid receptors associate with a number of different proteins in both a stable and transient fashion. Steroid receptor complex proteins include heat shock proteins (HSP 70 and HSP 90), immunosuppressant binding proteins called immunophilins (the FK 506 binding proteins, FKBP 52 & FKBP 54 and the cyclosporin binding protein, CyP-40) and at least three other proteins termed p23, p60 and p48. p23 along with HSP 70, HSP 90 and p60, combine with progesterone receptor (PR) as members of a transient intermediate complex. Cloned human p23 encodes a protein of 160 amino acids that is highly conserved between species and shows no homology to previously identified proteins. p23 is a highly acidic phosphoprotein with an aspartic acid-rich C-terminal domain and multiple potential phosphorylation sites. In vitro studies have suggested that p23 binds to HSP90 and is necessary for the binding of HSP 90 and CyP-40 to PR. While neither its exact function nor mechanism of action have been identified, p23 appears to be an important factor in PR function.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our p23/PTGES3 Antibody and receive a gift card or discount.